KEGG   Leishmania infantum: LINJ_36_7280Help
Entry
LINJ_36_7280      CDS       T01112                                 

Gene name
PDI-2
Definition
(RefSeq) protein disulfide isomerase
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
lif  Leishmania infantum
Pathway
lif04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lif00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LINJ_36_7280 (PDI-2)
Enzymes [BR:lif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LINJ_36_7280 (PDI-2)
Chaperones and folding catalysts [BR:lif03110]
 Protein folding catalysts
  Protein disulfide isomerase
   LINJ_36_7280 (PDI-2)
Membrane trafficking [BR:lif04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    LINJ_36_7280 (PDI-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA OST3_OST6 Thioredoxin_9 TraF Thioredoxin_3 Calsequestrin Redoxin HyaE Phosphatase
Motif
Other DBs
NCBI-GeneID: 5073504
NCBI-ProteinID: XP_001469404
UniProt: A4ICD5
Position
36:complement(2654759..2656192)
Genome map
AA seq 477 aa AA seqDB search
MQRSFLAFVVCAILFCVASAEVQVATKDNFDKIVSGDLTLVKFYAPWCGHCKTLAPEFVK
AADMLAGIATLAEVDCTKEESLAEKYQIKGFPTLYIFRNGEKVKDYDGPRTAAGIASYMK
AHVGPSIKAISKAEELEELKKETFPLCVVKTASADSEMASMITKVADSLRSQMNFVLVTD
AAISPNDAMESVTVYRKNAEREAYTGAAPMTAESVKRFLATAVLDYFGELGQESFQKYME
ANKGKPLGWVFVDKNTDPALKGSLVAVAEKYRSQVLLTFIDGDQYRPVSRQLGIPEDAKF
PAFVVDFERRHHVMETYTPVTAESVAAFVEKYIKGETKQTLMSDAIPAKETVNGLTTVVG
QTFAKYTDGTQNVMLLFYAPWCGHCQKLHPVYEKVAKSLESENVIIAKMDATTNDFDREK
FEVSGFPTIYFIPAGKPPIVYEGGRTADDIKAFVKSHLTASAAPSGGPSGNSDEEDL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgctcattccttgcttttgttgtgtgcgcgattctcttctgcgtagcatccgca
gaggtgcaggtggccaccaaggacaactttgacaaaatcgtaagcggggatctaacgttg
gtcaagttttacgctccgtggtgcggccactgcaagacactggctccggagtttgtaaag
gccgctgacatgctggccgggatcgcgacccttgcagaggtcgactgcaccaaagaggag
agcctcgctgagaagtaccaaatcaaggggttccccacattgtacatcttccgtaacggt
gagaaagtgaaggactacgatggcccccgcactgctgccggcatcgcgtcgtacatgaag
gcgcatgtcggtccatcgataaaggccatctcaaaggctgaagagctggaggaactcaag
aaggagactttcccgctgtgtgtggtgaaaacagcgagcgccgactcggagatggcgtcg
atgataaccaaggtggcggactctctccgctcgcagatgaactttgtgctcgtgacggat
gcagccatatctccgaatgatgccatggagtcggttacggtgtatcgcaagaatgcggag
cgcgaggcgtacaccggcgctgcgccgatgacggcggagtcggtgaagcgctttctcgcg
actgctgtgttggactactttggcgagctgggccaggagagctttcagaagtacatggaa
gcgaacaagggtaagcctcttgggtgggtgttcgtcgacaagaacacggatcctgcgctg
aaggggtcactcgtggcggtggcggagaagtaccgctcgcaggtgttgctaacgttcatt
gacggcgatcagtaccgccccgtctcgcgccagctgggcattcctgaggatgcgaagttc
ccggcgtttgtggtcgatttcgagcgccgccatcacgtgatggagacgtacaccccagtc
accgccgagtctgtcgctgcgtttgtggagaagtacatcaaaggcgagacgaagcagacc
ctgatgtccgatgcgattcctgctaaggagacggtgaacggcctcacgacggtggtgggt
cagacttttgcgaagtacacggacggcacacaaaacgtgatgctgctcttctacgcgccg
tggtgcgggcactgccagaagctgcaccccgtctacgagaaagtggccaagagtctcgag
tccgagaatgtgatcattgcaaagatggacgccacgacgaacgactttgaccgcgagaag
tttgaggtgtccgggtttccaacgatttacttcatccccgccggcaagccgccaatcgtg
tacgagggaggccgcactgcggatgacatcaaggcgtttgtgaagtctcacctgaccgcc
tcggccgctccatctggcggcccctccggcaacagtgacgaggaagatttgtag

DBGET integrated database retrieval system