KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00095Help
Entry
L63ED372_00095    CDS       T04121                                 

Gene name
aam_2
Definition
(GenBank) Acylamidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00970  Aminoacyl-tRNA biosynthesis
lih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lih00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    L63ED372_00095 (aam_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lih03029]
    L63ED372_00095 (aam_2)
Enzymes [BR:lih01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     L63ED372_00095 (aam_2)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     L63ED372_00095 (aam_2)
Mitochondrial biogenesis [BR:lih03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    L63ED372_00095 (aam_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ALK87324
UniProt: A0A0P0M6Q3
Position
111741..113159
Genome map
AA seq 472 aa AA seqDB search
MSTTPQDLTQSPAHELLALYRSGQASPVEVTRAVLSRIERVNPQINAFCLVDEKAAMASA
QASEARWQAHRQQGTPVGALDGVPTSIKDLILTQGWPTLRGSRTIDPNQPWDVDAPATAR
LREAGAVLLGKTTTPEFGCKGETNSPATGITRNPWNLNHTPGGSSGGTAAAVAAGLGPIG
VGTDGAGSVRIPAAFCGNVGLKPSFGRVPAYPLSPFGTVAHLGPHTMSVRDAALMTNVLK
QPDARDWTSLPPDASDYTIGLEDGIRGLKIAYSPTLGYAQNVDPEIAAAVHAAVQQLQAL
GAHVEQVDPGFEDPLEITTGLWFLGAYTVWKGLSAEQQAVADPDFKAEAEFGAQLSALQI
QQLNQRRGVLGSHMRQFMQRYDLLVTPAVAIPAFEARAAGTVAMNPVSMLGWTPFSYPFN
LTQQPAITVPCGQTRSGLPMGLQIVGPMFGDALVLRAARAYESAMPVARPNL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaacaccccaagacctgacgcagtccccagcccacgaactgctcgccctgtac
cgcagcggccaggcctcaccggtcgaagtcacccgggcggtgctctcgcgcatcgaacgt
gtcaacccacaaatcaacgccttttgtctggtggacgaaaaagccgccatggccagcgcc
caggccagcgaagcccgttggcaagcgcaccgccagcaaggcacgcccgtgggcgcattg
gacggtgtgcccacctccatcaaagacctgatcctgacgcaaggctggcccaccctgcgc
ggcagccgcaccatcgacccgaaccagccctgggatgtggatgctccggccaccgcccgc
ctgcgcgaagcgggcgcggtcttgctgggcaaaaccaccacgcccgagtttggttgcaag
ggcgagaccaattcacccgccaccggcatcacgcgtaacccctggaacctgaaccacacc
ccgggcggctcctcgggcggtacagccgctgccgtggcggcgggcctcgggcccattggc
gtgggcaccgacggcgcgggcagcgtgcgcattccggcggccttttgtggcaacgtgggc
ctcaaacccagctttggccgcgtgcccgcctaccctttgtcgccctttggcacggtggcc
cacctgggcccgcacaccatgagcgtgcgcgacgccgccttgatgaccaacgtgctcaag
caacccgatgcccgcgactggacatcgctgccccccgacgcgagcgactacaccataggt
ctggaagacggcatccgcggcctcaagatcgcctactcgcccaccttgggttatgcgcag
aacgtggaccccgaaatcgccgctgcagtgcatgccgctgtgcagcagcttcaggccttg
ggtgcccatgtggagcaggttgacccgggtttcgaagaccccttggagatcaccacgggg
ctttggtttttgggcgcctacaccgtctggaaaggcctaagcgccgagcagcaggccgtg
gccgaccccgacttcaaagccgaggccgagttcggtgcgcaactgagtgccttgcaaatc
caacaactcaaccaacgccgtggcgtcttgggctcgcacatgcgccagttcatgcagcgc
tacgacctgctggtcaccccagcggttgccattccggcttttgaggcgcgtgcggccggc
accgtggccatgaacccagtgtccatgctcggctggacgccgttcagctaccccttcaac
ctcacccagcaacctgctattaccgtgccctgtggccagacccgcagcggcttgcccatg
ggccttcagatcgtgggccccatgtttggcgacgccttggtgctgcgtgccgcccgggct
tacgagtcggccatgcctgtggctcgcccgaacttatga

DBGET integrated database retrieval system