KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00626Help
Entry
L63ED372_00626    CDS       T04121                                 

Gene name
crtF
Definition
(GenBank) Demethylspheroidene O-methyltransferase
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00906  Carotenoid biosynthesis
lih01100  Metabolic pathways
lih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    L63ED372_00626 (crtF)
Enzymes [BR:lih01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     L63ED372_00626 (crtF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_23 Methyltransf_25 Methyltransf_31 MTS Methyltransf_12 HTH_IclR MarR_2 DUF938 Methyltransf_11 DprA_WH Methyltransf_4 HTH_20
Motif
Other DBs
NCBI-ProteinID: ALK87853
UniProt: A0A0P0M7L9
Position
662144..663355
Genome map
AA seq 403 aa AA seqDB search
MSQPLDLAALQAHTAPTFKDAWQARLERWYAHPGLYRWSLGNPLTRWLTRRRTRQLFDLM
AGFVHSQVLLGCVRLDLFRALHQAPASLTDLARRTGLAPAVLQRLLLSAVALGLLEHRSQ
GRFGLGPLGVPLAQHEGIAQMIEHNHLLYQDMQDPVQFLNNAWSGGMAEYWPYAHEKPAV
TMPVEQVDRFTRYSQLMAASQGFVVQEILSSYFFDEHRCVLDVGAGKGRFVSELAAHAPH
LQFKMFDLPPVLALAREGLQAKGLTERVSLHPGSFLDDPLPEGADLITLVRVAHDHPDTV
VKQILQKAHAALPVGGVMLLAEPMAQPDEEAGQPEASVDAYFHFYLLAMGAGRLRTPQEL
QTMMEEAGFTHVELVPNAMPIHARILVGRKSQCLPSVSGKSVN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacccctggatctggccgccttgcaggcccacacagcccccactttcaaggac
gcttggcaggcccgcctcgagcgctggtacgcacaccctggcctgtaccgctggtcattg
ggcaatccgctcacgcgctggctcacgcgccgccgaacccgccagttgtttgatttgatg
gctggttttgtgcacagccaggtgctgctgggctgcgtgcgcctggacctgtttcgcgcc
ttgcaccaagcgcctgccagcttgaccgatttggcccgccgcaccggcttggccccggcg
gttttgcagcgattgctgctctcggccgtggcgctgggtcttttggagcaccgcagccaa
ggccgttttggtctgggtccactgggtgtgccgctggcgcagcacgagggcatcgcccaa
atgatcgagcacaaccacctgctctaccaagacatgcaggacccggtgcagttcttgaac
aacgcctggagcggtggcatggccgagtactggccctatgcccacgaaaaacccgctgtg
accatgcctgttgagcaggtcgacaggttcacccgctactcgcagctcatggccgcttca
caaggctttgtggtgcaggagattttgtcgtcctatttttttgacgaacaccgctgcgtg
cttgatgtcggggcgggcaagggccgctttgtgagtgagctggccgcgcatgcgccgcac
ctgcagttcaagatgtttgatctgccccctgtgctggcgctggcccgcgaaggtctgcaa
gccaagggtttgactgagcgtgtgagcctgcaccccggcagctttctggatgaccccctg
ccagaaggggcggacctgatcaccctggtgcgcgtggcgcacgatcaccccgatacggtg
gtgaagcagattttgcaaaaagcgcatgccgctttgcctgtgggcggcgtgatgttgctg
gccgaacccatggcccagccggatgaggaagccgggcagcccgaggcctcggtcgacgcc
tatttccacttttacctcttggccatgggggcagggcgtctgcgcaccccacaagagctg
caaaccatgatggaagaggccggattcacccatgtggagctggtgcccaacgccatgccg
atccatgcgcgcatccttgtggggcgcaaatctcagtgtttaccctcggtttctgggaaa
agtgtcaattaa

DBGET integrated database retrieval system