KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00657Help
Entry
L63ED372_00657    CDS       T04121                                 

Gene name
bchB
Definition
(GenBank) Light-independent protochlorophyllide reductase subunit B
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00860  Porphyrin and chlorophyll metabolism
lih01100  Metabolic pathways
lih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    L63ED372_00657 (bchB)
Enzymes [BR:lih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     L63ED372_00657 (bchB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red RE_Alw26IDE
Motif
Other DBs
NCBI-ProteinID: ALK87884
UniProt: A0A0P0M7G5
Position
complement(692522..694177)
Genome map
AA seq 551 aa AA seqDB search
MQLTLWTYEGPPHVGAMRVATAMTDVHYVLHAPQGDTYADLLFTMIERLPRRPPVTYTTF
QARDLGGDTAELFKDAARQAMARFNPAAMLVGSSCTAELIQDDPGGLAQALQLSIPVVAL
ELPSYQRKENWGASETFYQLCRHLVHKPATEKPVKARPTCNILGPSALGFRHRDDVKEIT
QLLNQLGVDVAVVAPLSASVTDVQKLAEADFNVVLYPEIGLAAAQWLQRQFDQPYTKTVP
LGSHATRDFIAEVCTLTGLPQPAQDPSNAHAHWYAKSVDSTYLTGKRVYIFGDATHVVAA
ARIASQEMDFEVVGMGTYSREFAREVRDCAKRYGVEALITDDYLEVEDQIQTLQPELILG
TQMERHIAKRQGIPCAVISAPVHVQDFPARYAPQMGFEGANVLFDTWVHPLMMGLEEHLI
GMFREDFEFHAGAAPSHLGSTRPAAENVAPIVAAPLSTPRSAPVATTSPMPVAAPARTDT
LTTDTVQKVAVPAQAASNQATWSPEAEKELGKIPFFVRGKARRNTERFAQDQGVATITVE
TLYDAKAHFSR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgacgctctggacttacgaaggaccgccccatgtgggggccatgcgcgtggcc
accgccatgacggacgtgcactacgtgctgcacgccccgcaaggcgacacctacgccgac
ctgctgttcaccatgatcgagcgcctgccgcgccgcccccccgtcacctacaccaccttc
caggcccgcgatctgggcggcgacacggccgaactcttcaaggacgcagcccgccaggcc
atggctcgcttcaaccccgctgcgatgttggtgggctcgtcttgcacggccgagctgatc
caggacgacccgggcggtttggcccaagccctccaactgagcatcccggtggtggctttg
gaactgccctcgtaccagcgcaaggagaactggggcgcgagcgagaccttttaccaactg
tgccgccacctggtgcacaaacccgccaccgaaaaacccgtcaaggcgcggcccacttgc
aacatcctcggccccagcgccctgggctttcgccaccgcgacgacgtcaaggaaatcaca
cagctgctgaaccaactcggcgtggacgtggcggtggttgcgcctttgagtgcgagtgtg
accgatgtgcaaaagctggccgaggccgacttcaacgtggtgctctaccccgaaattggc
ctggccgccgcacagtggttgcagcgccagtttgaccagccttacaccaagaccgtgcct
ctgggcagccacgccacacgcgacttcatcgccgaagtctgcacgctgaccggcctgccc
caacccgcacaagacccgagcaacgcacacgcccactggtacgccaagtcggtcgattcg
acctacctgaccggcaagcgggtctatatttttggcgacgccacgcacgtggtggccgcc
gcccgcatcgccagccaggagatggactttgaggtggtgggcatgggcacatacagccgc
gaatttgcccgcgaagtgcgcgactgtgccaagcgctatggggtggaagcgctgatcacc
gacgactacttggaggtcgaagaccagatccaaaccctgcaacccgagctgattttgggc
acgcaaatggagcgccacatcgccaagcgccaaggcattccttgcgcggtgatttcagcc
ccggtacatgtgcaggacttccccgcccgctatgcgccgcaaatgggttttgaaggcgcc
aacgtgctcttcgacacctgggtgcacccgctgatgatgggcttggaagaacacctgatc
ggcatgttccgcgaagacttcgaattccacgccggtgctgcgccctcgcatttgggcagc
acgcggcctgcggcagaaaacgtggcgccgatcgtcgctgcacctttaagcacaccccgt
agcgcacccgttgccaccacgtcgcccatgcccgtggctgcacccgcccgcaccgacacg
ctgaccaccgacaccgttcaaaaagtcgctgtccccgcccaagccgcttcgaaccaggcc
acctggagccccgaggccgaaaaggagctgggcaagatcccgttctttgtgcggggcaaa
gcgcgccgcaacaccgagcgatttgcccaagaccagggcgtggcgaccatcaccgtggag
acgctctacgatgccaaagcccacttcagccggtaa

DBGET integrated database retrieval system