KEGG   Limnohabitans sp. 63ED37-2: L63ED372_01857Help
Entry
L63ED372_01857    CDS       T04121                                 

Gene name
bktB_2
Definition
(GenBank) Beta-ketothiolase BktB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00071  Fatty acid degradation
lih00072  Synthesis and degradation of ketone bodies
lih00280  Valine, leucine and isoleucine degradation
lih00310  Lysine degradation
lih00362  Benzoate degradation
lih00380  Tryptophan metabolism
lih00620  Pyruvate metabolism
lih00630  Glyoxylate and dicarboxylate metabolism
lih00640  Propanoate metabolism
lih00650  Butanoate metabolism
lih00900  Terpenoid backbone biosynthesis
lih01100  Metabolic pathways
lih01110  Biosynthesis of secondary metabolites
lih01120  Microbial metabolism in diverse environments
lih01130  Biosynthesis of antibiotics
lih01200  Carbon metabolism
lih01212  Fatty acid metabolism
lih02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    L63ED372_01857 (bktB_2)
   00630 Glyoxylate and dicarboxylate metabolism
    L63ED372_01857 (bktB_2)
   00640 Propanoate metabolism
    L63ED372_01857 (bktB_2)
   00650 Butanoate metabolism
    L63ED372_01857 (bktB_2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    L63ED372_01857 (bktB_2)
   00072 Synthesis and degradation of ketone bodies
    L63ED372_01857 (bktB_2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L63ED372_01857 (bktB_2)
   00310 Lysine degradation
    L63ED372_01857 (bktB_2)
   00380 Tryptophan metabolism
    L63ED372_01857 (bktB_2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L63ED372_01857 (bktB_2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L63ED372_01857 (bktB_2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    L63ED372_01857 (bktB_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lih04147]
    L63ED372_01857 (bktB_2)
Enzymes [BR:lih01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L63ED372_01857 (bktB_2)
Exosome [BR:lih04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L63ED372_01857 (bktB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALK89061
UniProt: A0A0P0M9P9
Position
1948877..1950061
Genome map
AA seq 394 aa AA seqDB search
MSREVVVVSGVRTAIGTFGGSLKDIAPTELAAQVVREALSRAGTSGQDVGHVVFGHVVNT
EPKDMYLSRVAAINGGCAEGTPAFNVNRLCGSGLQAIVSASQAIMLGDCDIAIGGGAENM
SRAPYASLATRFGARMGDTKMIDMMIGALHDPFHNIHMGVTAENVAAKYGITREMQDALA
LESHNRAERATAEGRFKDQIMPVMLKSKKGDVAYTTDEHFRPDCKLEDMAKLKPVFVKEN
GTVTAGNASGINDAAAAVVLMEAGAAKARGAKPMARLVGYAHTGLDPKIMGVGPISATHA
VLKKTGLTVNDLDVIEANEAFAAQACAVTRELGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRVNGRYALVTMCIGGGQGIAAIFERM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgaagttgttgttgtcagcggtgtgcgcaccgccattggaacttttggcggc
agcctcaaggacattgcccccaccgagctggcggcgcaagtcgtgcgcgaagccctgtcc
cgcgcgggcacctctggccaagacgtcggccatgtggtctttggccatgtggtcaacacc
gaacccaaagacatgtacctgtcgcgcgtggcggccatcaacggcggctgcgccgagggc
acccccgccttcaacgtgaaccgcctgtgcggctcgggcctgcaagccatcgtgagcgcc
agccaagccatcatgctgggtgactgcgacatcgccattggcggtggtgcagaaaacatg
agccgtgcgccttatgccagtctggccacccgctttggcgcacgcatgggtgacaccaaa
atgatcgacatgatgatcggcgccctgcacgaccccttccacaacatccacatgggtgtg
acggccgaaaacgtggcggccaaatacggcatcacccgcgaaatgcaagacgccctggct
ctcgaaagccacaaccgcgccgaacgcgccacggcagagggccgcttcaaagaccagatc
atgccggtcatgctgaaaagcaaaaagggcgacgtggcctacaccaccgacgagcatttc
cgccctgactgcaagctcgaagacatggccaagctcaagcctgtgtttgtgaaagaaaac
ggcaccgtgaccgccggcaacgcatcgggcatcaacgacgccgcagccgctgtggtgttg
atggaagccggtgccgccaaggcgcgtggcgccaagcccatggcacgcttggtgggttac
gcccatacgggtctggaccccaagatcatgggtgtgggccccatctcggccacccacgcg
gtgctcaaaaagaccggcctcacggtgaacgacctggacgtgatcgaagccaacgaagcc
tttgccgcccaagcctgcgccgtgacgcgcgagttgggtctggacccggccaaggtcaac
cccaacggctcgggcatctcgctgggccaccccatcggtgccacgggtgcactgatcacc
gtgaaagccttgtacgagttgcagcgtgtcaacggccgctacgcactggtgaccatgtgc
atcggcggcggtcagggcatcgccgcgatttttgagcgcatgtga

DBGET integrated database retrieval system