KEGG   Limnohabitans sp. 63ED37-2: L63ED372_02726Help
Entry
L63ED372_02726    CDS       T04121                                 

Gene name
inhA
Definition
(GenBank) Isonitrile hydratase
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:lih00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    L63ED372_02726 (inhA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lih01002]
    L63ED372_02726 (inhA)
Enzymes [BR:lih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     L63ED372_02726 (inhA)
Peptidases [BR:lih01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   L63ED372_02726 (inhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ALK89925
UniProt: A0A0P0LHF7
Position
complement(2871084..2871974)
Genome map
AA seq 296 aa AA seqDB search
MNRRYFSRLLSWPSVVLGYLAMQTSQASAKPAAVQAPSKQAADEHHLATMDRYAPLIGGP
KITIGMLVYPGMFLQDLVGPLTVFEALMNKEIHLLWKDLEPVGNESPGPAALIPVKPTTT
FAQCPEQLDVLFVPGGVPGTFTMMEDPEVLAFLKAKGQTARYVTSVCTGSLILGAAGLLK
GYKATSYWDTRDVLKELGAIPTRGRIVVDRNRITGGGVTAGIDFGLKLVALLKSRVYAEA
VQLYLEYDPQPPFNAGSPEKAQPLARQFLKDMFAGMRANAFATAKRAMQRLLSGPT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtcgttatttctctcgtttgttgtcctggccctctgtggtgctgggctacttg
gccatgcagacgtcccaagcgtcggccaagcccgctgccgtgcaagcgccctcaaagcaa
gctgctgatgagcaccacttggccaccatggaccgttacgcgccgctcattggcggcccc
aaaatcaccatcggcatgctggtttatccgggcatgtttttgcaggatttggttgggccc
ttgaccgtgttcgaggccttgatgaacaaggaaatccacctgctttggaaagacctggag
ccagtgggcaatgaaagcccggggcctgcagcgctcattccggtcaaacccacgacgacc
ttcgcgcaatgccccgagcagctggacgtgttgtttgtgcccggcggtgtgccgggtacc
ttcaccatgatggaagacccggaagtcctcgcctttctcaaggccaagggtcaaaccgcc
cgctatgtgaccagcgtgtgcaccggctccttgattctgggggcagcgggtttgctcaag
ggctacaaagccacctcgtattgggacactcgcgatgtgctcaaggagctcggcgcgatt
cccacgcggggccgcattgtggtggaccgcaaccgcatcacaggcggcggcgtgacggcc
gggatcgactttggcctcaagttggtggcactgctgaaaagccgggtctatgccgaggcg
gtgcagctgtacctggagtacgacccgcagccccccttcaatgccggttcgcccgaaaaa
gcgcagccactggccagacagttcctaaaagacatgtttgccgggatgcgggccaatgcg
tttgcgacagccaagcgggcgatgcaaagactgctgagtgggccaacctga

DBGET integrated database retrieval system