KEGG   Listeria ivanovii subsp. ivanovii WSLC 3010: JL52_07225Help
Entry
JL52_07225        CDS       T03400                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lii  Listeria ivanovii subsp. ivanovii WSLC 3010
Pathway
lii00071  Fatty acid degradation
lii00072  Synthesis and degradation of ketone bodies
lii00280  Valine, leucine and isoleucine degradation
lii00310  Lysine degradation
lii00362  Benzoate degradation
lii00380  Tryptophan metabolism
lii00620  Pyruvate metabolism
lii00630  Glyoxylate and dicarboxylate metabolism
lii00640  Propanoate metabolism
lii00650  Butanoate metabolism
lii00900  Terpenoid backbone biosynthesis
lii01100  Metabolic pathways
lii01110  Biosynthesis of secondary metabolites
lii01120  Microbial metabolism in diverse environments
lii01130  Biosynthesis of antibiotics
lii01200  Carbon metabolism
lii01212  Fatty acid metabolism
lii02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JL52_07225
   00630 Glyoxylate and dicarboxylate metabolism
    JL52_07225
   00640 Propanoate metabolism
    JL52_07225
   00650 Butanoate metabolism
    JL52_07225
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JL52_07225
   00072 Synthesis and degradation of ketone bodies
    JL52_07225
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JL52_07225
   00310 Lysine degradation
    JL52_07225
   00380 Tryptophan metabolism
    JL52_07225
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JL52_07225
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JL52_07225
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JL52_07225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lii04147]
    JL52_07225
Enzymes [BR:lii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JL52_07225
Exosome [BR:lii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JL52_07225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIS65357
Position
complement(1480866..1482035)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAARTPIGKFGGSLKDISAVELGTTVVKGLLERANISPEEVDQVIFGNVLQSG
LGQNVARQIAINAGIPYQVPGVTINEVCGSGLKSIMFGKQAIQLGEAEIVVVGGTENMSQ
APLLLNPELVEEEVNPKNLKNSMLIDGLTDVFGEYHMGITAENVAKKFAVSREEQDAFAH
NSQMKAAKAQEKNLFEDEIIPVQLADGSFFNKDETIRANSTLEKLATLKSAFKEDGTVTA
GNASGINDGASAIILMSKEKAIAEKIPYLATIKITSEVGVDPAIMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPENKLNIYGGAIALGHPIGASGARIVVSLLN
ELKHENKRTGLASLCIGGGIGIAMVVERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgccgctcgcacaccaattggaaaatttggtggaagt
ttgaaagacataagtgcagtagaattaggaacaactgttgtaaaaggacttttagaaaga
gctaatatttcgcctgaagaagtagatcaagttatttttggtaatgtgttacaatctggt
cttggccagaatgtagctcgacaaatcgctattaatgcaggaattccttatcaagttcct
ggtgtaactattaatgaagtttgtggatctggtttaaagtccattatgtttggtaaacaa
gcaatccaactaggagaagcagaaattgttgtagtcggagggactgaaaacatgtcccaa
gcaccattactgcttaatcctgaattagtagaggaagaagtcaatcctaaaaatctgaaa
aatagtatgttaatcgatggtttaactgatgtgtttggtgaataccatatggggattacc
gctgaaaacgttgcaaaaaagtttgctgtgtctcgtgaagaacaagatgccttcgcacat
aactcgcagatgaaagcagcgaaagcccaagaaaaaaatctttttgaggatgaaattatt
ccagtacaattagcagatgggtcttttttcaacaaagatgaaaccattcgtgctaattcg
actttagaaaaacttgctacactgaaaagcgcttttaaagaagacggaacagtgacagca
gggaacgcatccggtattaacgacggtgcttctgccattattttaatgtctaaagaaaaa
gccatagcagaaaaaattccttatttagcaaccatcaagatcacatcagaagttggtgtt
gatcctgctattatgggatatgcgccttattatgcagtaaatgaagctttaacaaaaggc
ggctacagcatagacgaaatagacttattccaccttaatgaggcttttgcttctcaatca
gttgctgttgcaagagatttaaaaattccagaaaacaaattaaatatttatggcggcgct
attgcgttaggacacccaatcggtgcatctggagctcgcattgtcgtatcattattaaat
gagttaaaacacgaaaacaagcgcactggtctagcctcgttatgtattggtggcgggata
ggtattgcaatggttgttgaaagagcatag

DBGET integrated database retrieval system