KEGG   Listeria ivanovii subsp. ivanovii WSLC 3010: JL52_07910Help
Entry
JL52_07910        CDS       T03400                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lii  Listeria ivanovii subsp. ivanovii WSLC 3010
Pathway
lii00860  Porphyrin and chlorophyll metabolism
lii01100  Metabolic pathways
lii01110  Biosynthesis of secondary metabolites
lii01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lii00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JL52_07910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lii01007]
    JL52_07910
Enzymes [BR:lii01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     JL52_07910
Amino acid related enzymes [BR:lii01007]
 Aminotransferase (transaminase)
  Class III
   JL52_07910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIS65489
Position
complement(1623279..1624571)
Genome map
AA seq 430 aa AA seqDB search
MGNYPKSEKAFKESKKVLPGGVNSPVRAFNSVDASPVFMDHGKGAYISDIDGNDYIDYVL
SWGPLILGHANPAVVSAITSAAMKGTSFGTPTEIETELAKLVIERVPSIEIVRMVSSGTE
ATMSAIRLARGYTKRDKILKFEGSYHGHGDSLLIKAGSGVATLGLPDSPGVTKGLAADTI
TVPYNDVEGAKLAFEKFGEEIAAVIVEPVAGNMGVVPPIEGFLEGLRELTTKYGSLLIFD
EVMTGFRVDYYSAQGYYVVTPDITCLGKVIGGGLPVGAYGGKKEIMEQIAPAGSIYQAGT
LSGNPLAMNAGFETVRQLTPQHYDYFRALIKRMEEGLKEISVRREVPLAINKAGSMFGFF
FTDQKVINFDTAKTSDLEFFSNYYREMLVQGIFLPPSQFEGVFISTMHTEKEIDLTLEAF
DYTCKKLRAN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaactatccgaaatccgagaaagcttttaaagaatcgaaaaaagtcttaccaggt
ggagtaaacagtccggttcgtgcattcaattccgtggatgcctcgcctgtctttatggac
cacggaaaaggtgcttatatttcagatattgatggaaatgattatattgactatgtttta
tcttggggcccactaattttaggtcatgcaaatcctgctgttgtcagtgcaatcacatca
gccgcgatgaaaggaactagttttgggacaccaactgaaattgaaacagaacttgcaaaa
ctagttattgaacgtgttccttctattgaaatcgttcgaatggtttcttcaggaacagaa
gcaaccatgagtgctattcgattggcacgtggttatactaaaagagataaaattttaaag
tttgaaggtagctatcatggtcacggcgattctttattaattaaagctggttcaggcgtc
gcaacacttggactacccgactctcccggtgttacaaaaggacttgccgctgatactatt
accgttccatataatgatgttgaaggggcaaaactagcttttgaaaaatttggggaagaa
attgctgctgtaattgtggaaccagttgcaggtaacatgggtgtcgttcctccaattgag
ggctttttagaaggtctacgagaactgactaccaaatatggttcactgcttatatttgat
gaagtaatgacaggctttcgtgttgattattattctgcccaaggatattatgttgttaca
cctgatatcacttgtttaggaaaagtgattggcgggggtcttcccgttggtgcgtatgga
ggcaagaaagaaattatggaacaaattgctcctgcagggtctatttatcaagctggaacc
ttatctggaaatccgttagcgatgaatgccggatttgaaacggtaagacagcttacgcca
caacactatgattatttccgagcgctaattaagcggatggaggaaggcctaaaagaaatt
tccgttagaagagaggttccacttgcaatcaacaaagctggttcgatgtttggctttttc
ttcactgatcaaaaagttatcaattttgatacagcgaaaacaagtgatctagaattcttc
agcaattattaccgagaaatgcttgtacaaggaatctttttacctccatcgcaatttgaa
ggggtctttatttcgacaatgcacacagaaaaagaaattgatttaacgctagaagctttt
gattacacgtgtaaaaaacttcgcgctaattga

DBGET integrated database retrieval system