KEGG   Leptospira interrogans serovar Lai 56601: LA_0178Help
Entry
LA_0178           CDS       T00098                                 

Gene name
yidC
Definition
(RefSeq) preprotein translocase subunit YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil02024  Quorum sensing
lil03060  Protein export
lil03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lil00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    LA_0178 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LA_0178 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LA_0178 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lil03029]
    LA_0178 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lil02044]
    LA_0178 (yidC)
Mitochondrial biogenesis [BR:lil03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    LA_0178 (yidC)
Secretion system [BR:lil02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   LA_0178 (yidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 60KD_IMP
Motif
Other DBs
NCBI-GeneID: 1149521
NCBI-ProteinID: NP_710359
UniProt: P97041
Position
I:185139..187022
Genome map
AA seq 627 aa AA seqDB search
MEDRQTRLFLALILSMGIWMGVNYFFFPNTSTKKNTETKQTQSDKTSENTKQQITSGKTK
ESNSADPVVQKEKITPFDTKKSFIVTDSYIVEFSSLGGKISKFYMKDFTGPNGELIQVAR
KNPETVVVDGKSYQAVELSRDKGFDFNFSDSLVEISDSPWNYIQFSLTEDKINHSISFSA
VSPDRSYQLKKEFRFYPSENYFKLSISIINFSKEKLSFASQKNVRYLRTFGSLGPYPKDR
PLSDRDTANFFRFYYLGGSFQDTLDGSSSVGFWSSVGNFFTGNSGTDESFSIKTDKESGV
DFAGTGSRYFIAVADPLDHKPHGIVLDNRPKNESGAVLVYDNILLNPGENYNLDFASYIG
IRESEGMAFKNPELDPSQSKNSPFVGLSSDLNKSFNQGITTPFRNGIIWILKQIYRFTIP
NYGWSIIIFAILFKLVFYPLNQKQADSMKKMQELSPQLKTINEKFANDPKMRQQKTMELY
KKNNVNPVGGCLPMVIQIPIFIALYTAFSDTIDLWNSPFLWVKDLSEPDVIWTSPAIPYF
TQTGIGLNLLALLMVGTQVFQTRMTSVSMDPNQKMLMYVMPVMMLYIFWNMPSGVTLYWT
FQNVLSIGQQWITNHLKKTEEKKKAKV
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggaagatagacaaactagattgtttttagctttgattctcagtatgggaatttggatg
ggagtgaattattttttctttcctaacacatccacaaaaaaaaataccgaaacaaaacaa
actcaatctgataaaacgtccgaaaatacaaaacaacaaatcacttctggaaaaacaaaa
gaatccaattcagctgatcctgttgttcagaaagaaaaaataactccttttgatacgaaa
aaaagttttatcgtaacagattcttatatagtcgagttttcgtcgttaggcggaaaaatt
tccaaattttacatgaaagattttacgggtcctaacggagaactcattcaagttgctcgt
aaaaatcctgaaacggttgttgtagatggcaaaagttatcaagcggtggaattatccaga
gataaaggatttgatttcaatttttcagattctcttgtagaaatttctgattcaccttgg
aattatattcaattttccttaactgaagataaaatcaatcattccatttctttttcagca
gtttctccagataggagttatcaactgaaaaaagaatttcgtttttatccgagtgaaaat
tattttaaactttccatttctatcataaatttttcgaaagaaaaactttcatttgcctcc
caaaaaaatgttcgatatttgagaacctttggaagtcttggaccttatccaaaggataga
cctttgagcgatagggataccgcaaacttttttcgtttttattatttaggtggctctttt
caggatactctagacggaagttcttccgttggtttttggtcttcggttggcaattttttt
acgggaaattcgggaactgacgaatcttttagtattaaaacagataaagaatctggagtg
gattttgcaggaactggttctcgttattttattgcggtggccgatcctcttgatcataaa
ccacatggaatcgttttagataatagacctaaaaacgaaagtggagctgttttagtatat
gataatatacttttaaatcctggcgaaaattacaacttggattttgcatcctacataggt
attagagaaagcgaaggtatggcttttaaaaatcctgagttggatccgagtcaatctaaa
aacagtccttttgttggtctaagttccgatttaaataaatccttcaatcaaggtattact
actccttttcgaaatggaattatctggattttaaaacaaatctatcgttttacgattcca
aattacggttggagcatcattatttttgcgatccttttcaaactcgttttttatccgtta
aaccagaaacaagcggatagtatgaaaaaaatgcaagaactgagtccgcaacttaaaacg
atcaatgaaaagtttgccaatgatcctaagatgcgtcagcaaaaaacgatggaactttat
aagaagaataacgtaaatccagttggcggttgtcttcctatggtgattcaaattccgatt
tttatagcactttataccgctttctctgatacaatagatctttggaattcaccgttttta
tgggtcaaggatctcagcgaaccagacgtaatctggacttctcccgcgattccttacttt
actcaaaccggaattggtttaaaccttcttgctcttttgatggtagggacacaggtcttt
caaacgagaatgacttccgtatctatggatccaaatcaaaaaatgctaatgtatgtgatg
ccggttatgatgctttatattttttggaatatgccttccggagttactctttattggact
ttccaaaatgttctttctattggtcaacagtggattacaaatcatctaaaaaaaaccgaa
gaaaagaaaaaagcgaaagtttaa

DBGET integrated database retrieval system