KEGG   Leptospira interrogans serovar Lai 56601: LA_1131Help
Entry
LA_1131           CDS       T00098                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lil  Leptospira interrogans serovar Lai 56601
Brite
Enzymes [BR:lil01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LA_1131 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 GCD14 Methyltransf_23 Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 1150474
NCBI-ProteinID: NP_711312
UniProt: Q8F717
Position
I:complement(1136274..1136939)
Genome map
AA seq 221 aa AA seqDB search
MFSSSKVCNPILREQERKNMVDLQIASRGIRDKKILSAMLSIPRECFVPNSHILQAYEDK
PLPIGCNQTISQPFMVAWMSLLLEVRKGDRIFEIGTGSGYQSAVLIFLEATLYSVEFFDS
LSKTATQNLECWNPGCTQTNRFMIGSATEILKPELQFDKMISCAALPNLPDTKSSYFQSL
IPGGIFIFPMGKRDQYLIFAKRNLNDWSFESKGGVRFVPLL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttcgtctaaagtctgtaatccgattcttcgtgaacaagaaagaaaaaatatg
gtcgatcttcaaatcgcctctcgaggaattagagataaaaaaattctctctgcaatgctt
tcgattccaagagaatgttttgttccgaattcccatattttgcaagcatacgaagataaa
ccacttccaatcggttgtaatcaaaccatctctcagccgtttatggtagcatggatgtct
ttacttcttgaagttcgaaaaggagaccgtatctttgaaattggaaccggctcgggttat
caaagcgccgttttaatttttttagaagccacgttatactccgttgaattctttgactct
ctttctaaaaccgctactcaaaatttagaatgttggaatccaggctgtactcaaacgaat
cgttttatgatcggaagtgcgactgaaattctaaaaccggaacttcaatttgataagatg
atttcttgcgctgcacttccgaatcttccagatacaaaaagctcctactttcaatctctt
ataccgggaggaatttttatcttcccaatgggaaaacgagatcaatatttgatcttcgca
aaaagaaatctcaacgactggtcctttgaatccaaaggtggggttcgatttgttccttta
ctttaa

DBGET integrated database retrieval system