KEGG   Leptospira interrogans serovar Lai 56601: LA_1581Help
Entry
LA_1581           CDS       T00098                                 

Gene name
gcd1
Definition
(RefSeq) nucleotidyl transferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00051  Fructose and mannose metabolism
lil00520  Amino sugar and nucleotide sugar metabolism
lil01100  Metabolic pathways
lil01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LA_1581 (gcd1)
   00520 Amino sugar and nucleotide sugar metabolism
    LA_1581 (gcd1)
Enzymes [BR:lil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     LA_1581 (gcd1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 1150924
NCBI-ProteinID: NP_711762
UniProt: Q8F5T6
Position
I:1574241..1575044
Genome map
AA seq 267 aa AA seqDB search
MADLIHKNEINVLILAAGLGTRLKPLTDFWPKCLMPISGKPLLEIWLDQISQLKVSKVLV
NLHYLNEIVSSFLKRPRYKDWVKSVYEPELLGTAGTLQKNYDFFKGKTILLVHGDNLCLC
DFNSFVEFHFLKRPKGSLITMMTFRTDSPKSCGIVELDEDGVVQRFYEKVENPPGNLANA
AIYLIEPEVLDWIQEREYVNDFSNQVLPNFLGKIATWENKDIMRDIGNSEALAKAQKEVT
FPENNNLDEWETEFLSNSIHQSIQSIL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttggcggatctaattcataaaaacgaaattaacgttttaattctggcggctgggcttgga
actaggctaaaacctcttacggatttttggccgaaatgtttgatgccgatttccgggaaa
cctttgcttgaaatttggttggatcaaatttctcaattaaaagtttctaaagtattagta
aaccttcattatttgaatgagatcgtatcttcttttttaaaaagacctagatataaagat
tgggtcaaatccgtctatgaaccagagttattaggtacggcagggactcttcagaagaac
tatgatttctttaaagggaaaacaattcttttagttcatggcgataatctttgtttatgc
gattttaattcttttgttgaatttcattttttaaaaagacctaaaggttctcttataacg
atgatgacgtttcgaactgattctcccaaaagttgtgggattgtggagctggatgaagac
ggagtcgttcaaaggttctacgaaaaagtggaaaaccctccaggaaatctggcaaatgcc
gccatctacttgattgaaccagaagttttagattggattcaagaaagagaatacgtaaac
gattttagcaatcaagtgttgccaaatttcttgggaaaaatcgccacttgggaaaacaaa
gatataatgcgtgatattggaaattcagaggctttggcgaaggctcaaaaggaagttact
ttcccagaaaacaataatttagatgaatgggaaacagaatttttgtcgaactcgattcat
cagtcaattcagtcaatattatga

DBGET integrated database retrieval system