KEGG   Leptospira interrogans serovar Lai 56601: LA_2058Help
Entry
LA_2058           CDS       T00098                                 

Gene name
ddlA
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00473  D-Alanine metabolism
lil00550  Peptidoglycan biosynthesis
lil01100  Metabolic pathways
lil01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lil00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LA_2058 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LA_2058 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    LA_2058 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lil01011]
    LA_2058 (ddlA)
Enzymes [BR:lil01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LA_2058 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:lil01011]
 Precursor biosynthesis
  Amino acid ligase
   LA_2058 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RHH_1
Motif
Other DBs
NCBI-GeneID: 1151402
NCBI-ProteinID: NP_712240
UniProt: Q8F4I2
Position
I:2031215..2032270
Genome map
AA seq 351 aa AA seqDB search
MAKIAVFFGGSSTEHSISILTGCFICKTLHTMGHSVKPILLTKDGGWVVPSEYRMSIPFE
VSNSPDLFQEEFQKRYGVSRTNQIFSLDADIVFLGLHGGQGEDGTIQGFLEILGIPYTGS
GVLASAIAMDKTRANQIFLQSGQKVAPFFEIDKLEYLNSTDAVITKLETLGFPQFLKPVE
GGSSVSVYKITNREQLKEKLALIFESDSKVMSQSFLTGIEVSCGVLERYRDGKFKKIALP
ATEIVPGGEFFDFESKYKQGGSHEITPARISEQEMKRVQELAIAAHRSLGCSGYSRTDFI
IVNGEPHILETNTLPGMTETSLIPQQAKAAGISMEEVFSDLIEIGLKRSLY
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaagattgcagtcttttttggtggtagttctacggaacacagtatttcgattcta
accggatgttttatttgtaagacattgcatacaatgggacattcggtcaaacccattctt
ttaaccaaggatgggggttgggtcgtcccttctgaatatcggatgtcgattccgtttgaa
gtgtctaattctccagatttatttcaggaagaatttcaaaaaagatacggagtgtccaga
acgaatcaaattttttctttggatgcggatatcgtttttttaggtcttcacggaggccag
ggagaagacggaacgatccaagggtttttagaaattttaggaattccttatactggttct
ggagttcttgcttctgcgattgcaatggataaaaccagagccaatcagatatttttacaa
tccggtcagaaggttgcaccttttttcgaaattgataaattagaatatctaaattctacc
gatgcagtgattacaaaattagaaaccctaggttttccacaatttttaaaaccagtggaa
ggtggttcgagcgtctctgtttataaaataacaaatagggaacagctgaaagaaaaactt
gctttaatttttgaatccgattctaaagtgatgagtcagtcttttttgactggcattgag
gtttcttgtggggttttagaaagatacagagacggaaaattcaaaaagattgcgttaccc
gcaactgaaatcgttcctgggggagaattttttgacttcgaatctaaatacaaacaagga
ggttctcatgaaatcacacctgctagaatttcggaacaagaaatgaaacgtgttcaagaa
cttgctatagctgcacatagatctttaggatgtagcggatattctagaaccgattttatt
atcgtaaacggagaacctcatattttagagactaacacgttgcctggaatgacggaaacg
agtctaattcctcaacaagccaaagcggctggaatttctatggaagaagttttttccgat
ctaatagaaataggactaaaacgttctctttattag

DBGET integrated database retrieval system