KEGG   Leptospira interrogans serovar Lai 56601: LA_2133Help
Entry
LA_2133           CDS       T00098                                 

Gene name
putP
Definition
(RefSeq) sodium:solute symporter
Organism
lil  Leptospira interrogans serovar Lai 56601
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 1151476
NCBI-ProteinID: NP_712314
UniProt: Q8F4A8
Position
I:complement(2102745..2104295)
Genome map
AA seq 516 aa AA seqDB search
MSSYKEPQFKEKEFSGSFENEFCLIMHFSFLDLTVLLFYVGLVLFSGWFTSRKKDKDSAS
YFLAGKEISWIALSFSIVATETSTLTFLSIPGLSYSSNLTFLSLGLGFVLGRIIVAKLFI
PMYYKSGFISVYEWVGNHYGKISQKTVTFLFKLTRILGDGVRMYASAIPVAILLEVFLKQ
FSLLKTINLHIEILSLLLISGITILYTVQGGFRSVVWVDSIQFLIYVAGGIFALFYLGSI
LLKNGFDASYLIENANQTNKFQIFEWTDFSSAYFFPTAILGGILLTLGTHGVDQMFVQRI
LACRSESDAQKAMISSGIFVFFQFVLFLSIGVLLYFYYKDPSIPKDKVFSKFILEEVPSP
ITGFLLAAILASAMSTLSSSINSLSLTTKVDLKIEQFGSGTLSLFWGMILLLSSLLPLFL
TTGKKGLVELGLSISSYTVGPIISIFLSGRIQSFYYMQKLKDSFASLAIGLTPILTLIFG
KWTGSSFTLLVPFGIGTCWLLGFSLLQIQNRLTSQK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcttataaagaacctcaattcaaagaaaaagagttttccgggtcttttgaaaat
gaattctgcctgattatgcacttttcatttttagatctaaccgttttacttttctatgtt
ggtttggttcttttttcgggatggttcacttctagaaaaaaagataaggattccgcttct
tactttcttgcaggaaaagaaatttcttggattgctttgagcttttcaatcgttgccaca
gaaacgtctactcttacttttttgagcattcctggacttagttattcaagtaatcttacc
tttcttagcctcggtttgggttttgttttaggaagaattatcgtagccaaactttttatt
cctatgtattacaaatccggttttatttccgtttatgaatgggtaggaaaccactatgga
aaaatttctcaaaagacggtcacatttttattcaaactcactcgcattttaggagacgga
gtgagaatgtatgcatccgctattccggttgcgattttacttgaagttttcttaaaacag
ttttctttattaaaaaccataaatctacacatagaaattttaagtcttctactcatttcc
ggaatcacaattctttacacagttcagggaggatttcgttccgtggtctgggtagattcg
attcaatttttaatctacgtcgcaggaggaatttttgcgcttttctatttaggttctata
cttcttaaaaatggattcgacgcttcttatctgatcgaaaatgcaaatcaaacaaataag
tttcaaatttttgaatggacagatttttcatccgcttatttttttcccactgctatttta
ggaggaattcttttaaccttaggaacccacggagtagatcagatgtttgttcaaagaata
ctcgcgtgtagatcagaatcggacgcccaaaaggcgatgatttcttctggaatttttgta
ttttttcagttcgtattatttttaagcattggagttttattatatttttattataaagat
ccctctattcctaaagataaggttttttccaaatttattttagaggaagtaccttcgcca
atcacaggttttttattagccgctattttggcttcggctatgtctacattatctagttct
atcaattctctttctttgactactaaagtagatttaaaaatagaacaattcggttctggt
actttaagcttattctgggggatgattcttctcttaagttccctacttcctctattctta
acaaccggaaaaaagggtcttgtagaattaggactatctatctcttcttatactgttggt
ccaatcatttcaatttttctaagcggaagaatacaaagtttttattatatgcaaaaatta
aaggattcttttgcgtctttggcgatcggactaactccaattttaacattaattttcggt
aaatggaccggttccagttttactcttctggttccattcgggatcggaacctgctggttg
ctcggatttagtttactacaaattcagaatcgtctaacttctcaaaaatag

DBGET integrated database retrieval system