KEGG   Leptospira interrogans serovar Lai 56601: LA_2326Help
Entry
LA_2326           CDS       T00098                                 

Definition
(RefSeq) nucleoside-diphosphate-sugar epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00540  Lipopolysaccharide biosynthesis
lil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lil00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    LA_2326
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:lil01005]
    LA_2326
Enzymes [BR:lil01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     LA_2326
Lipopolysaccharide biosynthesis proteins [BR:lil01005]
 Unusual sugar
  LA_2326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 PS_pyruv_trans ThiF
Motif
Other DBs
NCBI-GeneID: 1151669
NCBI-ProteinID: NP_712507
UniProt: Q8F3S4
Position
I:complement(2303520..2304491)
Genome map
AA seq 323 aa AA seqDB search
MAKKKCIVTGGAGLIGSNLVQELNRLGIDDILVVDHLGTSSKWKNLVGKRYSDYLEKKTF
LEHTTRNFLLKDYDILFHLGACSSTTETDASYLVENNFEYTKLLAEESLKNGVRFVYASS
AATYGDGANGYDDKTPIDLLKPLNMYGYSKHMFDLYAQRRGFLNRITGIKYFNVFGYGEG
HKGDMRSVVLKGYEQIKKEGKIRLFKSYKPEYKDGEQKRDFLYAKDAAKITAYLAFGDHN
GIYNLGRGIAETWNDLVFAIFDTLKLSINIEYIEMPETLKSKYQYYTCADTTKLLKTGYS
EGFTQLKDAVSEYVTLLDEEEGT
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagaaatgtatcgttaccggtggtgcggggcttatcggttctaatctagtt
caagaacttaatagactaggaatcgatgatattctagttgtggatcatttgggaacttct
tccaagtggaaaaatttagtcggaaaaagatattcagattatctggaaaaaaaaacattc
ttagaacatacaactcgaaactttctattaaaagattatgatattttgtttcatttggga
gcctgttcttctactacagagacagacgcttcttatttagtggaaaataactttgaatat
acaaaacttcttgccgaagaatctttaaaaaacggagttcgatttgtatatgcttcttcc
gccgctacctatggagacggagccaatggatacgatgataaaactcccattgacttactc
aaacctttaaatatgtacggatattcaaaacatatgtttgatttatacgctcaaagaaga
gggtttttaaatcgaattactggaatcaaatatttcaatgtatttggatatggagaagga
cataagggggatatgagaagtgtagttcttaaggggtacgaacaaatcaaaaaagaaggt
aaaatccgtctttttaaatcgtataaacctgaatataaagacggagaacaaaaaagagat
tttttatacgcaaaagatgccgcaaaaatcaccgcctatttggcatttggcgatcataac
ggaatttacaatttaggaagaggaattgcagaaacctggaacgacctagtattcgcaatt
tttgatactttaaaactttctatcaatatagaatatattgaaatgccagagactcttaaa
tcaaaataccaatattatacttgtgcagataccacaaaacttttaaaaaccggttattcg
gaaggttttactcaattgaaggacgcagtcagtgaatatgtaaccctcctcgatgaagaa
gagggtacataa

DBGET integrated database retrieval system