KEGG   Leptospira interrogans serovar Lai 56601: LA_2623Help
Entry
LA_2623           CDS       T00098                                 

Gene name
gst
Definition
(RefSeq) glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lil00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LA_2623 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lil02000]
    LA_2623 (gst)
Enzymes [BR:lil01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LA_2623 (gst)
Transporters [BR:lil02000]
 Other Transporters
  Pores ion channels [TC:1]
   LA_2623 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 1151966
NCBI-ProteinID: NP_712804
UniProt: Q8F2Y8
Structure
PDB: 

Position
I:2606858..2607514
Genome map
AA seq 218 aa AA seqDB search
MIKLHGASISNYVNKVKLGILEKGLEYEQIRIAPSQEEDFLKISPMGKIPVLEMDGKFIF
ESGAILEFLDTIFPQTPKLIPEDPWEAARVREISTIIETYLDIPARRIYLPAAKVSPEIV
EEVHSTLVKGIKALQRVVRFSPYIAGNVFTLADCSGFAHLSVLDEELRPFYPNNHPLDLL
NGWKEYFVFMKTKAGPALVEKDKQILKKILARAKTKIG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacttcacggcgcaagtatcagtaattacgttaataaagttaaactaggtatt
ttagaaaaaggtttagaatacgaacaaatcagaatcgcaccttctcaagaagaggatttt
ttaaaaatcagtcctatgggaaaaattccggttctggaaatggatggaaaatttatattc
gagtcgggagctattttagaatttttagatacgatttttccacaaactcctaaactgatt
ccggaagatccctgggaagcggcaagagttagagaaatctccacgataatagagacctat
ttggatatacctgcaagaagaatctatctacctgcggccaaagtttctccggaaatagta
gaagaggttcattcaaccctagtcaaaggaatcaaggcacttcaaagagtggttcgattt
tcaccttacatagcaggaaatgtttttacactggcggattgttctggctttgcccaccta
tccgtgttagacgaagaactacgtcccttttatcctaacaaccatcccttagatctatta
aatggttggaaagaatactttgtatttatgaaaaccaaagcaggtcctgcacttgtagaa
aaagacaaacaaattcttaaaaaaattttagcaagagccaaaacaaaaatcggataa

DBGET integrated database retrieval system