KEGG   Leptospira interrogans serovar Lai 56601: LB_002Help
Entry
LB_002            CDS       T00098                                 

Gene name
metF
Definition
(RefSeq) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
lil  Leptospira interrogans serovar Lai 56601
Pathway
lil00670  One carbon pool by folate
lil01100  Metabolic pathways
lil01120  Microbial metabolism in diverse environments
lil01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lil00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LB_002 (metF)
Enzymes [BR:lil01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LB_002 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 1153928
NCBI-ProteinID: NP_714546
UniProt: Q8EY55
Position
II:2542..3423
Genome map
AA seq 293 aa AA seqDB search
MKKVSEIYGSAKGPVYSFEFFPPKTPEGDSKLMETVKELSLLNPDFVTVTYGAGGSTRDK
TVQILSQISKDYSFPTVSHFTCVGANKNQILETLKGIRSSGILNLMALRGDPPKGEGEFK
KVENGFGNATELVSFIRSEKLDFCIGGGCYPEKHPNAKTLEEDVENLKLKVDAGTDFLVS
QLFFVNSIFENFLNLVRKVGIQVPVIPGIMPITSFSQIDRFRSMAGCEFPSSLIQDLQEV
EHRPEEFYRRSLNFSVKQCRELLAMGVPGIHLYTLNQSHASYDIVRELKGESV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggtatctgaaatttacggttccgcaaaggggccagtgtattcgtttgagttc
tttcctccaaaaactccggaaggagattcaaaattgatggagaccgtgaaagaattgtct
ttactcaatcctgattttgttacggttacatatggagctggaggctctacaagagacaaa
accgtacagattttgtctcaaatttctaaggattattctttccctacggtttctcatttt
acctgtgtaggagctaacaaaaatcagattcttgaaactttgaaagggattcgatcatcc
gggattctaaacctgatggcattgcgtggagatccgccaaaaggagaaggagaatttaaa
aaagtagaaaatggttttgggaacgcaacggagctcgtttcttttattcgttctgagaag
ttggacttttgcattggaggtggttgttatcccgaaaaacatccgaatgcaaaaacttta
gaagaggatgtagagaatttaaagctgaaagtggatgcagggactgactttttagtgtct
caacttttttttgtgaattctatttttgaaaactttttgaatttagttagaaaggtcgga
attcaagttcctgttattccagggattatgccaatcacttctttttctcagattgataga
tttcgttctatggccggttgtgaattcccctcttctctcatccaagacttgcaagaagta
gaacatcgtcccgaagaattttacagaagaagtttaaacttttctgtaaaacaatgtaga
gagttattggcgatgggagttccaggaattcatctttatactctcaatcaatcacacgct
agttacgacatcgtaagggaactcaaaggtgaatctgtttag

DBGET integrated database retrieval system