KEGG   Limnohabitans sp. 103DPR2: L103DPR2_00031Help
Entry
L103DPR2_00031    CDS       T04120                                 

Gene name
thlA_1
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
lim00071  Fatty acid degradation
lim00072  Synthesis and degradation of ketone bodies
lim00280  Valine, leucine and isoleucine degradation
lim00310  Lysine degradation
lim00362  Benzoate degradation
lim00380  Tryptophan metabolism
lim00620  Pyruvate metabolism
lim00630  Glyoxylate and dicarboxylate metabolism
lim00640  Propanoate metabolism
lim00650  Butanoate metabolism
lim00900  Terpenoid backbone biosynthesis
lim01100  Metabolic pathways
lim01110  Biosynthesis of secondary metabolites
lim01120  Microbial metabolism in diverse environments
lim01130  Biosynthesis of antibiotics
lim01200  Carbon metabolism
lim01212  Fatty acid metabolism
lim02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    L103DPR2_00031 (thlA_1)
   00630 Glyoxylate and dicarboxylate metabolism
    L103DPR2_00031 (thlA_1)
   00640 Propanoate metabolism
    L103DPR2_00031 (thlA_1)
   00650 Butanoate metabolism
    L103DPR2_00031 (thlA_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    L103DPR2_00031 (thlA_1)
   00072 Synthesis and degradation of ketone bodies
    L103DPR2_00031 (thlA_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L103DPR2_00031 (thlA_1)
   00310 Lysine degradation
    L103DPR2_00031 (thlA_1)
   00380 Tryptophan metabolism
    L103DPR2_00031 (thlA_1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L103DPR2_00031 (thlA_1)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L103DPR2_00031 (thlA_1)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    L103DPR2_00031 (thlA_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lim04147]
    L103DPR2_00031 (thlA_1)
Enzymes [BR:lim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L103DPR2_00031 (thlA_1)
Exosome [BR:lim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L103DPR2_00031 (thlA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALK90455
UniProt: A0A0P0MCL8
Position
complement(38366..39568)
Genome map
AA seq 400 aa AA seqDB search
MTPSHDPVVIVSAARTPMGSFQGDFASLAAHDLGGAAIKAAVERAAAGSKFSADLVTEVL
FGNCLMAGQGQAPARQAGFKGGLPKSAGAVTMSKMCGSGMRAAMFAHDMLVAGTHDVLVA
GGMESMTNAPYLMLKGRGGYRMGHDKIYDHMMLDGLEDAYEAGRSMGTFGEDCAAKYNFS
RAEQDAFAIASVERAKAATASGAFQAEITPVTFKTRAGETTVSVDEGPGKVKLDKVTSLK
PAFKKDGTITAASSSSINDGAAALVMMRQSTADKLGCKPLARIVSHATHAQEPEWFATAP
VGATQKALAKAGWTVGDVDLWEVNEAFAVVPMALMKELNVPHEKVNVNGGACALGHPIGA
SGARIMVTLIHALKARGLKKGLATLCIGGGEGTAVALELV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccccatcacatgaccccgtcgtcatcgtcagcgcagcacgcacgcccatgggcagc
tttcagggtgactttgcgtccttggcggcacacgacttgggcggcgctgccatcaaagcg
gccgtagaacgtgccgctgcaggttcaaagttcagtgccgatttggtgactgaagtgttg
tttggcaattgcctgatggcaggccaaggccaagcacctgcgcgtcaagcaggcttcaaa
ggcggtctgcccaagagtgcaggcgccgtcaccatgtccaagatgtgtggctctggcatg
cgcgccgccatgtttgcgcacgacatgttggtagcaggtacgcacgatgtgttggtggct
ggcggcatggaaagcatgaccaacgcaccctacttgatgctcaagggccgcggtggttat
cgcatgggccacgacaaaatttacgaccacatgatgctcgatggtttggaagacgcgtac
gaagccggccgctccatgggcacctttggtgaagactgcgctgccaagtacaacttctcg
cgcgcagagcaagacgcctttgccattgccagcgtagagcgtgccaaggccgctacagcc
tccggtgcattccaagcagaaatcacgcctgtcaccttcaaaacacgtgccggtgaaacc
accgtgtctgtggacgaaggtcccggcaaagtgaagctagacaaagtgaccagcttgaaa
cctgcgttcaaaaaagacggcaccatcaccgccgcttctagctcttccatcaacgatggc
gctgcagcactggtcatgatgcgtcaaagcaccgcagacaaattgggatgcaaacctttg
gcacgcattgtgagccacgccacacacgcgcaagaacctgaatggtttgccacagcccca
gtgggtgccacgcaaaaagccttggccaaagccggttggactgttggcgatgtggacttg
tgggaagtgaacgaagcctttgctgtggtgcccatggccctcatgaaagagctcaatgtg
ccacacgagaaggtgaacgtgaacggtggtgcgtgcgccttgggtcacccgattggcgca
tccggtgcgcgcatcatggtgacgctcattcacgcactcaaagcacgtggcctgaaaaaa
ggtttggccacactgtgcatcggtggcggtgaaggcactgcggtcgcgttggaattggtt
taa

DBGET integrated database retrieval system