KEGG   Limnohabitans sp. 103DPR2: L103DPR2_02754Help
Entry
L103DPR2_02754    CDS       T04120                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lim  Limnohabitans sp. 103DPR2
Pathway
lim00471  D-Glutamine and D-glutamate metabolism
lim00550  Peptidoglycan biosynthesis
lim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    L103DPR2_02754 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    L103DPR2_02754 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lim01011]
    L103DPR2_02754 (murD)
Enzymes [BR:lim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     L103DPR2_02754 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:lim01011]
 Precursor biosynthesis
  Amino acid ligase
   L103DPR2_02754 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALK93132
UniProt: A0A0P0MIK6
Position
complement(2837703..2839217)
Genome map
AA seq 504 aa AA seqDB search
MNYLQGQHILILGLGASGLAMARWCAFAGAEVTVADTREAPANLAILQSELPQVHWVSGP
FSASLVEGSAIRAVFASPGLAPADTAPVLDAAKSMGLWTGGELTLFVQALEKLKATRDYT
PKVLAITGTNGKTTVTALTGQLIERAGKTVKVAGNIGPTLLDTLRECVDDALPEVWVLEL
SSFQLDNAGPFEPTAATVLNVTQDHLDWHGSMDAYAAAKEKIFGEQSLMLLNRDDARVMA
MLPDPIRAKLQKPIVREHITYGAGMPERPGDFGLETVNGMTWLVRALESDETRRLRKGEV
EEIHIQRLMPADALRIRGRHNAVNALAALALASSTGSSLASMLFGLREYKGEPHRVESVA
IVNDIEYFDDSKGTNVGATVAALVGLGSERRVVVILGGDGKGQDFSPLAEPVSRYTRAVI
LIGRDAPLIRDALSLCGVPLIDAATLPEAVNAAKEVAQAGDAVLLSPACASFDMFRDYPH
RAQVFCQAVAEIAEATGQIVETSQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcttcaaggccaacacattttgattttggggctaggcgcttcaggcctggcc
atggcgcgctggtgcgcgttcgcaggtgcagaagtcaccgttgccgatacgcgtgaagca
ccggccaatttggccatcttgcaaagcgagttgccccaagtgcattgggtttcgggtcct
ttcagcgccagtctggttgaaggcagcgccattcgtgctgtgtttgcaagcccaggtttg
gcacctgccgatacagcccctgtgttggatgctgccaagtccatggggctgtggacgggt
ggcgagctgactttgtttgtgcaagccctcgaaaaactcaaggccacacgcgactacacc
cccaaagtcttggccatcacgggcaccaacggcaaaaccacggtgaccgcattgaccggc
caattgattgagcgcgccggtaaaacagtcaaggtggccggcaacattggccccaccttg
ttggacaccttgcgcgaatgtgtagacgacgcattgcctgaagtgtgggtgctcgagttg
tcgagtttccaattggacaacgcaggaccgtttgagccaactgcggccaccgtgctgaac
gtcacccaagaccatttggattggcacggcagcatggacgcctacgctgctgccaaagaa
aagatttttggtgaacagtctttgatgctgttgaaccgcgacgatgcgcgtgtcatggcc
atgctgccagaccccatccgcgccaagctgcaaaaacccattgttcgagaacacatcacc
tacggtgctggtatgcccgagcggccaggtgactttggtttggaaaccgtcaacggcatg
acctggttggtgcgggctttggaatctgatgaaacacgtcgcctgcgcaaaggggaagtg
gaagagattcacattcaacgcctgatgccagccgatgcattgcgcattcgcggtcgtcac
aatgccgtgaatgctttggctgctttggctttggccagtagcacgggaagcagcttggct
tcgatgttgtttggtttgcgtgaatacaagggcgagccacaccgagtggaatcagtcgcc
atcgtcaatgacatcgaatattttgacgacagcaaaggcaccaatgtgggcgccaccgtg
gctgcgttggtgggcttgggttctgagcgccgcgtggtggtgattttgggtggtgatggc
aaaggtcaagatttctcgccgctggccgaacctgtctctcgttacacgcgtgccgtgatt
ttgatcggccgcgatgctccccttatccgtgacgcgttgtcactgtgtggtgtgcccttg
atcgatgccgccacattgcccgaggctgtcaacgcagccaaagaggtggcccaagcaggc
gacgctgtgttgctgtcgcccgcttgtgcaagttttgacatgttccgtgactaccctcac
cgcgcgcaagtcttctgccaagctgtggcagagattgcagaggcaaccggccaaattgtg
gagacctctcaatga

DBGET integrated database retrieval system