KEGG   Listeria innocua (serotype 6a): lin1253
Entry
lin1253           CDS       T00067                                 
Name
(GenBank) lin1253
Organism
lin  Listeria innocua (serotype 6a)
SSDB
Motif
Pfam: PcfJ PBSX_XtrA
Other DBs
NCBI-ProteinID: CAC96484
Pasteur: LIN01253
UniProt: Q925W4
Position
1259830..1261191
AA seq 453 aa
MKREARNYIDNKLKPPKAFFDWCFSQIPTYKWSNKKETILASNRKNCSVIEQKLRKNSRL
TFFGKLNVFGIVLVTSKRIEIQSYAFWNRVVEGKEMIEFDLVNFEQFADGEHVKVAISDG
KMWFGLIPIYGGMSGGPYSMIRLFENDWKEKIRSKSELKYLEIPHLDFKEIETIYKYRVE
IEFLQKIKARQLSKEVMYPVTQYTNGSFRKTVDMRTINAKWLKENKPFFKNSDRGFMEFE
LARRIQKRRGKVVSGIEKYLDYRAINKIPEGVGIVRFQNWIIKNKVDFSYYLDYLNLMRD
LNIAIDSENIIMPKNLVIAHDNAVKLLYQMKHEVEEQQYKMRFEKIKDLEKTIDNYAFIV
PKQASDLLTEGKALSHCVGGSNYIKQHIEGKTTIIFVRDKQYLEKSLYTLEYKNGQIYQL
RGKHNCEPTHDVQEAANNWAASVKSKTKVLQHS
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaagagagaagcacgaaattatattgataataaattaaagccaccaaaagcctttttt
gactggtgtttctcacaaattccaacttacaaatggtccaacaaaaaagaaactattcta
gcttccaatcgaaaaaactgcagtgttattgaacagaagttaagaaaaaattctagattg
acattttttggtaaattgaacgtgttcggtattgtcttagttacatcgaaaagaattgag
atacaaagttacgcgttctggaatcgagtagtggaaggaaaagaaatgattgaatttgat
ctagtcaattttgaacaatttgctgatggagaacacgtaaaggttgccatcagcgacggc
aagatgtggtttggtttaattccaatatatggtgggatgtctggaggtccttactcaatg
attcgattgtttgaaaatgactggaaagaaaaaattcgaagtaaatcagagcttaagtac
ctagaaataccgcacttagactttaaagaaattgaaactatatataaatatagagttgaa
attgaatttttgcagaaaattaaagcaagacaattgtccaaggaagttatgtatcccgta
acacaatatacaaatggatcgtttagaaaaacggtagatatgcggacaattaatgcgaag
tggttgaaagaaaacaagcctttctttaagaactcggacagaggttttatggaatttgaa
ttagcaagaagaatacagaaacggcgaggaaaggtagtttctggaattgaaaaatatctt
gattaccgtgctatcaacaaaatcccagaaggagtaggaatagttcgctttcagaattgg
atcattaagaataaagtggattttagctactatctggattatctaaacctaatgcgagac
ttaaatattgcaatcgatagcgaaaacataattatgcctaaaaatttagtaatagctcat
gataacgcggtcaaattactgtaccaaatgaaacatgaagttgaagaacaacaatataaa
atgagatttgagaagataaaagacttagaaaaaacgatagataattacgcttttattgtc
cctaaacaagcttctgatttattaacagaaggcaaagcattaagtcattgtgtgggtggt
agtaattatattaaacaacacattgaagggaaaacaacgattatttttgttcgtgataag
cagtacttagaaaagtcattgtatacacttgaatacaaaaatggccaaatttaccaactg
agaggtaagcacaattgtgagccaacccacgatgtgcaagaggctgcaaacaactgggct
gcatcagtaaaaagtaaaacaaaggtattacaacatagttga

DBGET integrated database retrieval system