KEGG   Listeria innocua (serotype 6a): lin1266
Entry
lin1266           CDS       T00067                                 
Name
(GenBank) similar to phage protein
Organism
lin  Listeria innocua (serotype 6a)
SSDB
Motif
Pfam: HTH_23 HTH_28 Terminase_5 HTH_Tnp_1 Sigma70_r4_2 GerE DUF1323
Other DBs
NCBI-ProteinID: CAC96497
Pasteur: LIN01266
UniProt: Q92CC3
Position
1269646..1270482
AA seq 278 aa
MDNLDKELIKKDYLAGMKNKEIVEKYGISPNTLKAWIRRYGWKDEKEKGASKTKKMGAPF
GNVNAKGNSGGGAPLGNKNAIGNSGGGAPFGNKNALFTGEFEIIDPDYFSDEEKKIYNSL
TDHPLAHANNIIKDEYIRKRRMMKRLNELENNLSESEKEIKKAYLKQDIRKVIERDGQKA
IMTVPELVLVEQKEETKRKIDDVLRLEESITRQNGVLLRALRDKSAIIAQLSMLPLNQEK
TQKEIEMLELEIQELKGIDLEKPLEIRVSRAVKKLGRS
NT seq 837 nt   +upstreamnt  +downstreamnt
atggataacctagataaagagctcataaaaaaagactatttggcaggaatgaagaacaaa
gaaatagtagaaaaatatggcatatctccgaataccttgaaggcgtggattagaagatat
ggttggaaagatgaaaaagaaaagggtgcatccaaaacaaaaaaaatgggcgcacccttt
ggaaatgtaaacgcaaaagggaattcgggcggtggggcacctttaggcaataaaaacgcg
ataggtaactctggcgggggtgcaccctttggtaataagaatgcactttttacaggagag
ttcgaaattattgatcctgattactttagcgatgaagaaaaaaaaatatacaattctctg
acagaccaccccctagcccacgctaataatatcattaaagatgaatatattcggaaaaga
agaatgatgaaacgactaaacgaattagaaaataatttgtcggagtctgaaaaagagata
aaaaaagcttacttaaaacaagatataagaaaagttattgaaagagacggacagaaagca
attatgacagttcctgagctagtacttgttgaacaaaaagaagaaactaaacgtaagata
gatgatgttttacggctagaagaatctattacaagacaaaacggtgttttacttagagca
ttgagagacaagtctgcaataattgctcagctatctatgctaccgctcaatcaagaaaaa
acacaaaaagaaatcgaaatgctagaactcgaaatacaagagcttaaaggtatagactta
gaaaaaccgcttgaaattagagtctcaagggcggtgaagaaacttggtagaagctaa

DBGET integrated database retrieval system