KEGG   Listeria innocua (serotype 6a): glyQHelp
Entry
glyQ              CDS       T00067                                 

Definition
(GenBank) similar to glycyl-tRNA synthetase alpha chain
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lin00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    glyQ
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lin01007]
    glyQ
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lin03016]
    glyQ
Enzymes [BR:lin01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     glyQ
Amino acid related enzymes [BR:lin01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   glyQ
Transfer RNA biogenesis [BR:lin03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    glyQ
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: CAC96727
Pasteur: LIN01496
UniProt: Q92BQ1
Position
complement(1499168..1500058)
Genome map
AA seq 296 aa AA seqDB search
MNLQTMIRTLQDYWSEQDCIMLQSYDVEKGAGTMSPYTFLKAIGPEPWKAGYVEPSRRPA
DGRYGENPNRLFQHHQFQVVMKPSPDNIQELYLGSLEKLGINPLEHDIRFVEDNWENPSL
GCAGLGWEVWLDGMEITQFTYFQQVGGLECFPVTSEITYGVERLASYIQDKENVFDLEWT
EGISYRDIFFQAEFENSKYAFETSNTDMLLTLFDTYEREAARQMQEGLVFPAYDYVLKCS
HTFNLLDARGVVSVTERAQYIGRIRNLARRIAKTFYESREKLGFPLVKEEGGKRHE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaaacaatgattagaacgttacaagattattggtccgaacaagattgtatt
atgttgcaatcgtatgatgtggaaaaaggtgctggtacaatgagcccttatactttctta
aaagcaattggtccagaaccttggaaagcaggttatgtggagccttctcgtcgtccagca
gatggccgttacggagaaaacccaaacagattattccaacatcatcaatttcaagtagtg
atgaaaccttctcctgacaacattcaagagctttaccttggctcattagaaaaattagga
attaacccgttagaacatgatattcgttttgtggaagataactgggaaaacccttcgtta
ggatgcgcaggacttggatgggaagtatggttagatgggatggaaatcactcaatttact
tatttccaacaagtaggcggcttagaatgtttcccagttacatctgaaattacttatggt
gtggaacgtttagcaagctatattcaagataaagaaaatgtatttgatttagaatggaca
gaaggtattagctatcgcgatattttcttccaagcagaattcgaaaactccaaatatgcc
tttgaaacttctaatacagatatgctattaactctttttgacacatatgaaagagaagca
gctcgtcaaatgcaagaaggactagttttcccagcgtatgactatgtattaaaatgttcg
catacctttaacttactagatgctcgcggcgttgtttcagtaactgaacgcgctcagtat
atcggtcgtatcagaaacttagcaagacgtatcgccaaaacattttatgaatcacgagaa
aaacttggcttcccattagtcaaagaagagggaggaaaacgtcatgagtaa

DBGET integrated database retrieval system