KEGG   Listeria innocua (serotype 6a): infCHelp
Entry
infC              CDS       T00067                                 

Definition
(GenBank) translation initiation factor IF-3
  KO
K02520  translation initiation factor IF-3
Organism
lin  Listeria innocua (serotype 6a)
Brite
KEGG Orthology (KO) [BR:lin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lin03012]
    infC
   03029 Mitochondrial biogenesis [BR:lin03029]
    infC
Translation factors [BR:lin03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    infC
 Prokaryotic Type
   infC
Mitochondrial biogenesis [BR:lin03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    infC
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF3_C IF3_N
Motif
Other DBs
NCBI-ProteinID: CAC97127
Pasteur: LIN01897
UniProt: P0A3L2
Position
complement(1913783..1914298)
Genome map
AA seq 171 aa AA seqDB search
MSKDMLVNDGIRAREVRLIDQDGEQLGVKSKIDALQIAEKANLDLVLVAPTAKPPVARIM
DYGKFRFEQQKKDKEARKNQKVIVMKEVRLSPTIDEHDFDTKLRNARKFLEKGDKVKCSI
RFKGRAITHKEIGQKVLDRFAKACEDLCTIEQRPKMDGRSMFLVLAPLHEK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
attagcaaagacatgttggtaaacgatgggattcgtgcacgtgaagtaagattgatcgac
caagacggtgaacaattaggcgtgaagagtaaaatcgatgcgcttcaaattgctgaaaag
gctaatcttgatctagtgcttgttgctccaacagcgaaaccgccagtagctcgtattatg
gactacggtaaattccgttttgaacaacagaagaaagataaagaagcccgtaagaaccaa
aaagtcatcgtaatgaaggaagttcgtttaagtccaacaattgacgaacatgattttgat
acgaagctacgtaatgcacgtaaattccttgaaaaaggcgataaagtaaaatgctctatc
cgttttaaaggtcgtgccattacacacaaagaaatcggtcagaaggtgcttgaccgtttt
gcaaaagcgtgcgaagacctttgtacaattgagcaaagaccaaaaatggacggacgttcc
atgttcttagtcctagcaccacttcatgaaaagtaa

DBGET integrated database retrieval system