KEGG   Listeria innocua (serotype 6a): lin0362Help
Entry
lin0362           CDS       T00067                                 

Definition
(GenBank) similar to dehydrogenase/reductase
  KO
K22251  glycerol dehydrogenase [EC:1.1.1.6]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00561  Glycerolipid metabolism
lin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    lin0362
Enzymes [BR:lin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     lin0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C RmlD_sub_bind DUF853 3HCDH_N 3Beta_HSD Ldh_1_N zf-C4H2
Motif
Other DBs
NCBI-ProteinID: CAC95595
Pasteur: LIN00362
UniProt: Q92EU6
Position
complement(377415..378179)
Genome map
AA seq 254 aa AA seqDB search
MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLDIKEDVKDVAAQINPS
RTLALQVDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNL
KGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAP
YNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLI
TGENLIIDGGYTIK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaaggttttgataaagattttaacattacagacaaagtagccgtggtaact
ggggcagcaagcgggattggtaaagcaatggcagagcttttttccgaaaaaggagcttat
gttgtcttgcttgatattaaagaagatgtaaaagatgtcgcagcgcaaattaacccttca
agaacgctcgcacttcaagtcgacattactaagaaagaaaacatcgaaaaagtcgttgcc
gaaattaaaaaagtctatccaaaaatcgatattttagccaattcagctggtgtcgcgctt
ctcgaaaaagcagaagacttaccagaagaatactgggataaaacaatggaactgaactta
aaaggttcgttcctaatggcgcaaattatcggtcgcgaaatgattgcaactggcggcggt
aaaatcgttaatatggcctctcaagcttctgtcatcgcacttgataaacacgttgcctac
tgtgctagtaaagctgcgattgtttcaatgactcaagtgctagcaatggaatgggcgcct
tacaacattaatgttaatgcgatttccccaaccgttatcttgacggaactaggcaaaaaa
gcttgggcaggtcaagtcggcgaagacatgaaaaaattaattccagccggtagatttggt
tatccagaagaagttgccgcatgtgcactctttttagtaagtgacgcagcgagcctaatt
actggtgaaaaccttattatcgacggcggttatacgattaaataa

DBGET integrated database retrieval system