KEGG   Listeria innocua (serotype 6a): lin1202Help
Entry
lin1202           CDS       T00067                                 

Definition
(GenBank) conserved hypothetical protein, similar to B. subtilis YsnA protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:lin00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    lin1202
Enzymes [BR:lin01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     lin1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: CAC96433
Pasteur: LIN01202
UniProt: Q92CH0
Position
1216291..1216902
Genome map
AA seq 203 aa AA seqDB search
MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS
LLNQTVIADDSGLIVDVLNGAPGVYSARYAGVAHDDAKNNEKLLKNLEGVEPAKRTARFH
CTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAEKKNEIS
HRANAIKQLEKDLAEVVEKVTKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattattattgccaccgcaaataaaggaaaagcaaaagaattcgaaaaaatc
tttgcgaagtttaatatcgaagttgctacccttgctgattttccagaaattggtgaaatt
gaagaaacaggcacgacctttgctgaaaatgctgctcttaaagcagaaacggtcgctagc
ttgctaaatcaaacagttattgctgatgattcaggtttaattgtagacgtgcttaacggg
gctcctggtgtctattctgcacgctatgctggggtcgctcatgatgatgcaaaaaataat
gaaaaactacttaaaaatttagaaggcgtagaaccagcaaaaagaactgctcgtttccac
tgtacacttgctgtggctacaccctctgagaaaacaagtttttatacaggagaggtagaa
ggagttatcgcagaacaactatgcggtacaaacggcttcggttatgatccactatttttc
ttaccagaattcggtcttacaatggcagaaattccagcagagaaaaagaatgaaatcagc
caccgagctaatgctattaaacagctagaaaaagatttagcagaagttgtagaaaaagtt
actaaaaagtga

DBGET integrated database retrieval system