KEGG   Listeria innocua (serotype 6a): lin1453Help
Entry
lin1453           CDS       T00067                                 

Definition
(GenBank) similar to Acetyl-CoA:acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00071  Fatty acid degradation
lin00072  Synthesis and degradation of ketone bodies
lin00280  Valine, leucine and isoleucine degradation
lin00310  Lysine degradation
lin00362  Benzoate degradation
lin00380  Tryptophan metabolism
lin00620  Pyruvate metabolism
lin00630  Glyoxylate and dicarboxylate metabolism
lin00640  Propanoate metabolism
lin00650  Butanoate metabolism
lin00900  Terpenoid backbone biosynthesis
lin01100  Metabolic pathways
lin01110  Biosynthesis of secondary metabolites
lin01120  Microbial metabolism in diverse environments
lin01130  Biosynthesis of antibiotics
lin01200  Carbon metabolism
lin01212  Fatty acid metabolism
lin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    lin1453
   00630 Glyoxylate and dicarboxylate metabolism
    lin1453
   00640 Propanoate metabolism
    lin1453
   00650 Butanoate metabolism
    lin1453
  Lipid metabolism
   00071 Fatty acid degradation
    lin1453
   00072 Synthesis and degradation of ketone bodies
    lin1453
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    lin1453
   00310 Lysine degradation
    lin1453
   00380 Tryptophan metabolism
    lin1453
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    lin1453
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    lin1453
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    lin1453
Enzymes [BR:lin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     lin1453
Exosome [BR:lin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lin1453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAC96684
Pasteur: LIN01453
UniProt: Q92BU1
Position
complement(1451921..1453090)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLKRANIAPERVDQVIFGNVLQAG
LGQNVARQVAIKAGIPYKVPGVTINEVCGSGLKAIMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKDLKNSMIIDGLTDVYGEYHMGITAENVAEKYSVSREDQDKFAH
NSQMKAARAQEKNLFEEEIVPVQLPDGSFFEADETIRANSTLEKLATLKSVFQEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYLATIKVTSEVGVDPAYMGYAPYYAVNEALEKA
GYSIADIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIVVSLLN
ELQHEDKHTGVASLCIGGGIGIAIIIERV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgccgttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggtgctaccgctttaaaaggtgttttaaaaaga
gctaacattgctccagaacgtgtggatcaagttatttttggcaatgttttacaagcaggt
ctcggtcaaaacgtagcaagacaagtcgctattaaagccgggattccttataaagtacca
ggtgtgacaattaatgaagtttgtggctctggtttaaaagctatcatgcttggtagacaa
gcaattcaactaggggaggctgacattgtagcagtaggagggaccgaaaatatgtcccaa
gcgccgttattacttaacccggaactagctggtgaagaaatcaacccgaaagatttaaaa
aatagcatgattattgatggacttacagatgtatacggggaataccacatgggaattact
gcagaaaatgtggcagaaaaatattccgtttcaagagaagaccaagataaatttgcccat
aattcgcaaatgaaagctgctcgtgcgcaagaaaaaaacctttttgaagaggaaatagtt
cctgttcaacttccagatggttcattttttgaagctgacgaaacaattcgcgctaattct
actttagaaaaacttgctacgcttaagagtgtttttcaagaaggtggaactgttactgca
ggtaatgcttctggtatcaatgacggggcttctgcaatcattttaatgtccaaagaaaaa
gctgtggcagaaaacatcccttatttagctacaattaaagtaacttcagaagtcggagtg
gatccagcttatatgggttatgcgccatactatgcagttaatgaagcgctagaaaaagca
ggctactcaatagctgatattgatttattccatttaaatgaagcttttgcatctcaatca
gttgcagttgcaagagatttaaaaatacctgaagagaaacttaatatttatggtggagca
atagcgctaggccatccaatcggtgcttcaggagctcgcattgttgtttcattgttaaat
gagttacaacacgaagataaacatacaggtgtagcttccttatgtattggcggcggtatt
ggtattgcaattatcattgaaagagtataa

DBGET integrated database retrieval system