KEGG   Listeria innocua (serotype 6a): lin1807Help
Entry
lin1807           CDS       T00067                                 

Definition
(GenBank) some similarities to methyl-accepting chemotaxis proteins
Organism
lin  Listeria innocua (serotype 6a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal PAS_4 PAS_3 PAS_9 PAS Prefoldin_2 DUF948 H_kinase_N Sec5 DASH_Dad2 Tropomyosin_1 AAA_13 DUF1216 DUF1664 Laminin_II FadA ApoLp-III FH2 DUF327 Prominin TMPIT Mt_ATP-synt_D CCDC-167 Med7 IncA Vps53_N Reo_sigmaC DUF745
Motif
Other DBs
NCBI-ProteinID: CAC97038
Pasteur: LIN01807
UniProt: Q92AW1
Position
1814546..1815448
Genome map
AA seq 300 aa AA seqDB search
MNVNAETEDATLLLDGLLQNVAIIRFDTNKKVTYANALFAEAMGYTEEEMLQLSHPDLCF
PDFVQTASYKEMWTNLLAGQKFQNKIERKNARGERVWFEATYIPIIREETVVGVAKIATD
ITRREETVHDFASGLKSMATNLKEHSSVGKTRSEALLELVKSITKESNENTDTLHDLQTE
AQNIHGIINTINGIASQTNLLALNAAIEAARAGDAGRGFSVVAEEVRKLSSRVEEAIKEV
EKSVNGITQEINTISSGTERVEAKVEESQEVLILSLEDFSQIESASTALDQNAGAFTKMI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttaatgcggaaacagaagacgcaactctccttctcgatggtttacttcaaaac
gtagcaataattcgttttgatactaataaaaaagtaacttacgctaatgcacttttcgcg
gaagctatggggtatacagaagaagaaatgttgcaattatcgcaccctgacttatgcttt
ccagactttgtacaaactgcgagctacaaagaaatgtggacaaatctactagctggacaa
aaatttcaaaataaaattgaacgaaaaaacgctcgtggcgaacgtgtttggttcgaagcg
acttatatccctattattcgcgaagaaacagtagtcggagttgcaaaaatagcaactgat
attacgagaagagaagaaactgtccatgattttgcctctggtttaaaaagcatggctaca
aatttaaaagaacattccagtgttggaaaaacgcgcagtgaagctctccttgaactcgtg
aaatcaatcacgaaagaatcaaatgaaaataccgatacccttcacgatttgcaaacagaa
gcacaaaatattcacggcattattaatacaattaacggaattgcttctcagaccaattta
cttgccttaaatgcagcaattgaagcagcacgtgctggtgatgctgggcgtggatttagt
gttgtagctgaagaagttcgtaaactttcaagtcgtgtagaagaagcaattaaagaagta
gaaaaaagtgtcaacggtatcacccaagaaattaatactatctcaagtggtacagaacgt
gtcgaagcaaaagtcgaggaaagccaagaagtccttattttatctttagaagattttagc
caaattgaatctgcctctactgccttggatcaaaatgccggtgctttcacaaaaatgatt
taa

DBGET integrated database retrieval system