KEGG   Listeria innocua (serotype 6a): lin2047Help
Entry
lin2047           CDS       T00067                                 

Definition
(GenBank) similar to GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00790  Folate biosynthesis
lin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lin2047
Enzymes [BR:lin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     lin2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI TAF6_C DUF2785
Motif
Other DBs
NCBI-ProteinID: CAC97277
Pasteur: LIN02047
UniProt: Q92A75
Position
complement(2061894..2062463)
Genome map
AA seq 189 aa AA seqDB search
MEQIDKQKIADAVKVILEAVGENPEREGLIDTPMRVARMYEEVFAGLKKDPSVHFDTIFE
EQHEELVLVKDIRFSSMCEHHLVPFFGVAHVAYLPQNGRVAGLSKLARVVDDVSRRPQLQ
ERITTTVAEIMMDKLKPLGVMVIMEAEHMCMTIRGVNKPGTKTITSAVRGAFKNDDKLRS
EVLALIKHN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaatagacaaacaaaaaattgctgacgcagtgaaagttattttagaagcagtg
ggagaaaatccagaacgtgaaggactaattgatacaccaatgcgagtagctcgtatgtat
gaagaagtttttgctggactcaagaaagatccttctgttcatttcgatactatttttgaa
gaacaacatgaagaactagtgcttgtaaaagatattcgtttttcctctatgtgcgaacat
catcttgttcctttttttggcgtagcacatgtggcttatttgcctcaaaatggacgagtt
gcagggcttagtaaacttgctcgtgtagtggatgatgtgagtcgtcgtccgcaacttcaa
gagcgtattactacgactgttgcagaaattatgatggataaattaaaaccactgggagtc
atggtgataatggaagcagagcatatgtgcatgaccatccgtggtgtcaataaacctgga
actaaaacaattacaagcgcagtacgaggcgcttttaaaaatgacgataagcttagaagt
gaagttttggctttaattaagcataattaa

DBGET integrated database retrieval system