KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_01115Help
Entry
JL53_01115        CDS       T03402                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00230  Purine metabolism
lio00240  Pyrimidine metabolism
lio00760  Nicotinate and nicotinamide metabolism
lio01100  Metabolic pathways
lio01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lio00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JL53_01115
   00240 Pyrimidine metabolism
    JL53_01115
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    JL53_01115
Enzymes [BR:lio01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     JL53_01115
CD molecules [BR:lio04090]
 Proteins
  JL53_01115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Big_6 Metallophos Stn1
Motif
Other DBs
NCBI-ProteinID: AIS61418
Position
complement(209036..211387)
Genome map
AA seq 783 aa AA seqDB search
MNKFFKKTTYFLLVAGLTIGLTAPFTGNSVQAAADTVPIQILGINDFHGALETASKDASG
SPIGGADYLATNLDNATSSFLQANPDATADNAIRVQAGDMVGASPAVSGLLQDEPTMKVL
QKMNFEIGTLGNHEFDEGLPEYKRILDGVSTSKFGPIVEAYPRVKGDMKIVAANVVNKGT
NTVAEGFSPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIKDYDFLDEAETIVKYSAELRG
QGVNAIVVLSHVPALSTGNPNTGTKQDVAGEAANMITKANELDPNNSVDLVLAGHNHQYT
NGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVSPPDAKITYNTRSVSPNSDITAVTED
AKSRIEGVINETIGLANKDVISRDTNLDNQAIDDKESELGNMITDAQRYMANKAGADVDF
AMTNNGGIRADLTTRLANGQNEITWGAAQAVQPFGNILQVVEMSGADILEALNQQYLSNQ
TYFLQISGLKYTFTDTDDLDHAYKVASVTTEDGTPLKSDQKYKVVINDFLFGGGDGFSAF
KKANLVTAIDPDTETFINYIKEQKAAGKVITAQKEGRKVYKSQAEIDKETADAAIKALKD
ATKINKLAEKDTTLTGTTLPGATVGVQKTNSNAKLVRAAGPSATADANGKFSVDISSLDF
KKGDQITTTVTDTNGYSATFQTTVQAAATTPPDNGNGNNGGTDSGNGNGNNGGTDNGNTN
NGSGTTNGGTTTTEKPATSTPNGTATSSKVSTALPTTGDTAGLATVFGLILTTTALYVLR
KKN
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaatttttcaagaaaaccacatattttttactcgtagcagggctcacaatcgga
ctaactgcaccattcaccgggaattcagtacaagcagcagcggataccgttcctatccag
attttaggaataaatgatttccacggagcgcttgaaacagcctctaaagatgcatctggc
tccccaattggcggagcagactatttagcaaccaacttggataatgctactagctcattt
ttacaagcaaatcctgatgctacagcagataatgccattcgtgtccaagcgggtgacatg
gtcggtgctagcccggccgtttctggtttgcttcaagacgaaccaacaatgaaagtcctt
caaaaaatgaacttcgaaatcggcacacttgggaatcatgagtttgatgagggattgcct
gaatacaaacgaattttagatggtgtttctacgagcaaattcgggccaattgtggaagct
tatccacgagttaaaggtgatatgaaaattgttgccgcaaatgttgttaataaagggaca
aacacagttgcagaaggattttcaccctattatgtaaaagaaattgatggcgtcaaagtt
ggcttcatcggtatcgttacaaccgaaatccctaatttagtactggcaaatcatattaaa
gactacgatttccttgatgaagcagaaacaatcgtgaaatactctgctgaacttagagga
caaggcgttaatgctatcgttgttttatctcacgttcctgcactatctactggaaatcca
aacactggaacaaaacaagatgtagctggggaagctgctaatatgataacgaaagcaaac
gaattagacccaaataattccgtcgatttagtccttgcggggcataatcatcaatacaca
aacggattagttggtaaaactcgtatcgtccaaagttacaataacggtaaagctttttcc
gatgtaaccggcgaacttgataaaacaacaggcgatttcgtttcaccaccagatgctaaa
attacatataatacgagaagcgtctctccaaattccgatattacagctgtaactgaagat
gcgaaaagccgcattgaaggagttattaacgaaactatcggacttgcaaataaagacgtc
atttcccgcgatacaaatctagacaaccaagcaatcgatgataaagaatccgaacttggt
aatatgattactgacgcacaacgctatatggcaaacaaagcaggcgctgacgtagatttt
gctatgacaaataatggcggcattcgtgctgatctcacaacacgtctggcaaatggccag
aacgaaattacctggggtgcggcacaagctgttcaaccattcggaaacattcttcaagta
gtggaaatgtctggtgcagatattttagaagcactaaaccaacaatatttaagtaaccaa
acttactttttacaaatttctggattaaaatacactttcactgatacagatgacttagat
catgcttacaaagttgctagtgttacaacagaagatggtactccgttaaaatctgaccaa
aaatacaaagtcgtaatcaatgacttcttattcggtggtggagacggattttctgcattc
aaaaaagcgaatctagttacagcgattgacccagataccgaaacatttatcaactatatc
aaggaacaaaaagctgctggaaaagtaattacagctcaaaaagaaggccgtaaagtttac
aaatctcaagctgaaatcgacaaagaaacagctgatgcagccattaaagcattaaaagac
gcaacaaaaatcaacaaactagctgaaaaagacacaacgctaactggtactactttacca
ggtgctacggttggtgttcaaaaaacaaattcaaacgccaaattagtacgtgctgctgga
ccaagcgcaacagcggatgcaaacggtaaattctctgtagacatctcttctctagacttt
aaaaaaggtgaccaaatcacaactactgtcactgatacgaacggttacagcgccacattc
caaacaaccgtgcaagcagccgcaactacacctcctgataatggaaatgggaataatggc
ggaaccgatagtggtaacggaaatgggaataatggagggactgacaacggtaacaccaat
aatggttcaggaacgactaatggcgggactaccacaactgaaaaaccagctacatctaca
ccaaatggcactgctactagtagtaaagtaagtactgcgttaccaacaactggtgataca
gcaggacttgcaacagtatttgggttaattttaaccactactgcgctttatgttttgcga
aagaaaaactga

DBGET integrated database retrieval system