KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_07905Help
Entry
JL53_07905        CDS       T03402                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00071  Fatty acid degradation
lio00072  Synthesis and degradation of ketone bodies
lio00280  Valine, leucine and isoleucine degradation
lio00310  Lysine degradation
lio00362  Benzoate degradation
lio00380  Tryptophan metabolism
lio00620  Pyruvate metabolism
lio00630  Glyoxylate and dicarboxylate metabolism
lio00640  Propanoate metabolism
lio00650  Butanoate metabolism
lio00900  Terpenoid backbone biosynthesis
lio01100  Metabolic pathways
lio01110  Biosynthesis of secondary metabolites
lio01120  Microbial metabolism in diverse environments
lio01130  Biosynthesis of antibiotics
lio01200  Carbon metabolism
lio01212  Fatty acid metabolism
lio02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JL53_07905
   00630 Glyoxylate and dicarboxylate metabolism
    JL53_07905
   00640 Propanoate metabolism
    JL53_07905
   00650 Butanoate metabolism
    JL53_07905
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JL53_07905
   00072 Synthesis and degradation of ketone bodies
    JL53_07905
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JL53_07905
   00310 Lysine degradation
    JL53_07905
   00380 Tryptophan metabolism
    JL53_07905
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JL53_07905
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JL53_07905
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JL53_07905
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lio04147]
    JL53_07905
Enzymes [BR:lio01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JL53_07905
Exosome [BR:lio04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JL53_07905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIS62649
UniProt: A0A097BDB1
Position
complement(1612221..1613390)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAARTPIGKFGGSLKDVSAVELGTTVVKGLLERTNIAPEKVDQVIFGNVLQAG
LGQNVARQIAINAGIPYQVPGVTINEVCGSGLKSIMFGRQAIQLGEADIVVVGGTENMSQ
APLLLNPELKDEAFNPKNLKNSMLIDGLTDVFGEYHMGITAENVAEKFVVSREEQDAFAH
NSQMKAAKAQEKNLFEDEIIPVQLTDGAFFQKDETIRANSTLEKLATLKSAFKEGGTVTA
GNASGINDGASAIILMSKEKAIAENIPYLATIKVTSEVGVDPAIMGYAPYYAVNEALTKG
GYSINDIDLFHLNEAFASQSVAVARDLEIPENKLNIYGGAIALGHPIGASGARIVVSLLN
ELKHENKQTGLASLCIGGGIGIAIVVEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgccgctcgaacaccaattggaaaatttggtggaagt
ttgaaagatgtaagtgcagtagaattaggaacaactgttgtaaaaggacttttagaaaga
actaatattgcgcctgaaaaagtagatcaagttatttttggtaatgtgctacaagctggt
cttggccagaatgtagctcgacaaatcgctattaatgcaggaattccttatcaagttcct
ggtgtaaccattaatgaagtttgtggatctggtttaaagtccattatgttcggtagacaa
gcaatccaactaggagaagcagatattgttgtagtaggagggactgaaaatatgtcccaa
gcaccattattacttaatcctgaattaaaagatgaagcgtttaatccaaaaaacctaaag
aatagtatgttaatcgatggtttaaccgatgtatttggcgaataccatatgggaattacc
gctgaaaacgttgcagaaaaatttgttgtgtcgcgtgaagaacaagatgccttcgcacat
aattcgcaaatgaaagcagcgaaagcacaagaaaaaaatctttttgaagatgaaattatt
ccagtgcaacttacagatggagcttttttccaaaaagatgaaaccattcgcgctaattcg
actttagaaaagcttgctacactaaaaagcgctttcaaagaagggggaacggtaacagca
gggaacgcatctggtattaacgatggtgcttctgccattattttaatgtctaaagaaaaa
gctatagcagaaaatattccttatttagcaacaattaaggttacatcagaagtcggtgtt
gatcctgcaattatgggatatgcgccatactacgctgttaatgaagctttaaccaaaggc
ggttactcgattaatgacatagatttattccatcttaatgaggcatttgcttctcaatcg
gttgctgttgctagagaccttgaaattccagaaaataaattaaatatttatggcggtgct
attgcattagggcacccaattggcgcttctggagcacgcattgtcgtttcattattaaat
gaattaaaacatgaaaacaaacaaactggtctagcctctttgtgtatcggtggtggaata
ggaattgcgatagtggttgaaaaagcataa

DBGET integrated database retrieval system