KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_09785Help
Entry
JL53_09785        CDS       T03402                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00970  Aminoacyl-tRNA biosynthesis
lio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lio00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    JL53_09785
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lio03029]
    JL53_09785
Enzymes [BR:lio01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     JL53_09785
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     JL53_09785
Mitochondrial biogenesis [BR:lio03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    JL53_09785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey MOZART1
Motif
Other DBs
NCBI-ProteinID: AIS62986
UniProt: A0A097B692
Position
complement(1998455..1999885)
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTNSKIFSSAPAHFGAEPNTNTTVVDLGMPGVLPVLNKRAVEFGM
KAAMAINCEIAEHTKFDRKNYFYPDNPKAYQISQFDKPIGEHGWIEIEVGGKKKKIGITR
LHLEEDAGKNTHTSHGYSLVDINRQGTPLIEIVSEPDIRSAEEAYAYLEKLKSIIQYTGV
SDVKMEEGSMRCDANISIRPIGQEEFGVKTELKNLNSFNNVRKGIEYEEKRQAEVLLSGG
IIEQETRRFEEATGKTSLMRIKEGSDDYRYFPEPDLVDLFIDDAWKERIRAEIPELPDKR
QIRYINDLGLPAYDAMVLTLTKEMSDFFEATIEAGADAKQASNWLMGEVSAYLNAEQKEL
HDTGLTPENLAGMIKLIEAGTISSKIAKKVFRELALNGGNAEQVVKDKGLVQISDEGALR
TIIGEILDNNEQSITDYKNGKDRAVGFLVGQVMKATKGQANPPMVNKLLLEEMNKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacagttattggacttgaggttcatgtagagttaaaaaccaattcaaaa
atattttcttctgcgccagctcattttggagcagaaccaaatacaaatacaacggtggta
gacttaggtatgccaggcgttttaccagtattaaataaacgtgcggtagagttcggaatg
aaagctgcaatggcgattaattgtgaaattgctgaacatacaaaattcgaccgcaaaaac
tatttttacccagataatcccaaagcataccaaatttctcaattcgataaaccaatcggc
gaacatggctggattgaaatcgaagtaggtggtaaaaagaaaaaaatcgggattactcgt
cttcatttagaagaagatgctggtaaaaatacccatacttctcatggttattcattagtg
gatattaaccgtcaaggaacaccactaatcgaaatcgtttctgaaccagatattcgttct
gcggaagaggcatatgcatatcttgaaaaattaaaatcgattattcaatataccggcgta
tctgatgtgaaaatggaagaaggctccatgcgttgtgatgccaatatttctatccgtcca
attggccaagaagaatttggggtaaaaacagagctgaaaaacttaaactcatttaacaat
gtccgtaaagggattgaatacgaagaaaaacgccaagcagaagtacttctttctggtgga
attatcgaacaagaaactcgccgttttgaagaagcaactggaaaaacttccttgatgcgt
attaaagaaggctcagacgattatcgttacttcccagaaccagatttagtagatttattt
attgatgatgcttggaaggaacgtatccgcgccgaaatcccagaacttccagataaacgt
caaattcgatacattaatgaccttggcctaccagcatatgatgcgatggtacttacatta
acaaaagaaatgtcagatttctttgaagcaacaattgaagctggagcagatgctaaacaa
gcttctaactggttgatgggtgaagtttctgcttatttaaatgcagaacaaaaagaattg
catgacaccgggttaacacctgaaaacttagctggtatgattaaactaattgaagctgga
acaatttcctctaaaattgctaaaaaagttttccgtgagttagctttaaatggcggcaat
gcggaacaagtagttaaagataaagggttagttcaaatttcggatgagggcgcattacga
acaatcatcggagaaattttagacaacaatgaacaatcaattaccgactataaaaacggg
aaagatcgtgcagttggtttcttagttggtcaagtaatgaaagcaacaaaaggtcaagcg
aatccaccaatggttaataaattattattagaagaaatgaataaacgctaa

DBGET integrated database retrieval system