KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_10730Help
Entry
JL53_10730        CDS       T03402                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00230  Purine metabolism
lio00240  Pyrimidine metabolism
lio01100  Metabolic pathways
lio01110  Biosynthesis of secondary metabolites
lio01130  Biosynthesis of antibiotics
Module
lio_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
lio_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
lio_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:lio00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JL53_10730
   00240 Pyrimidine metabolism
    JL53_10730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lio04131]
    JL53_10730
Enzymes [BR:lio01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     JL53_10730
Membrane trafficking [BR:lio04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    JL53_10730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AIS63155
UniProt: A0A097BEQ9
Position
complement(2192246..2192689)
Genome map
AA seq 147 aa AA seqDB search
MEQTYVMVKPDGVERGLIGDIVARMEKKGIKIVAAKLIQIDRELAEKHYAEHIGKSFFED
LIGFITSGPVFAMVLEGDDVIKTARRMMGKTNPLEADAGTIRADYAVHTNRNVIHGSDSP
ESAKREIELFFKPEEILTYRKSVDKWI
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacttatgtaatggttaaaccggatggtgtggaacgaggacttattggtgat
attgtagcaagaatggagaaaaaaggtatcaaaatagtagcggcaaagttaatacaaatc
gaccgcgaattagcagaaaaacattacgctgagcatattggtaaatcatttttcgaagat
ttgattgggtttatcacatctggcccagtttttgcgatggttttagaaggcgacgatgtc
attaaaacagcgcgtcgaatgatgggaaaaaccaatccgctagaagctgacgcgggaact
atccgcgctgattatgcagtacatactaatcgaaatgtcattcatggttctgatagccct
gaaagtgccaaacgagaaattgaattattttttaagccagaggaaatcttaacttatcga
aaatcagtagataaatggatttag

DBGET integrated database retrieval system