KEGG   Lawsonia intracellularis PHE/MN1-00: LI0324Help
Entry
LI0324            CDS       T00354                                 

Gene name
thiE
Definition
(GenBank) Thiamine monophosphate synthase
  KO
K00788  thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00730  Thiamine metabolism
lip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LI0324 (thiE)
Enzymes [BR:lip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     LI0324 (thiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMP-TENI IMPDH NMO QRPTase_C DUF561 NanE MAGSP
Motif
Other DBs
NCBI-ProteinID: CAJ54380
UniProt: Q1MRJ6
Position
405585..406238
Genome map
AA seq 217 aa AA seqDB search
MAYILPGSSLDADLYAITDDALSFNRSVIEVVKQLLDAGIRIIQYREKNKSSNSMLKDCI
TIKKLTEEANACFIVNDHVDIAVLCNADGVHLGQDDLPVDKVRELIGKEKIIGLSTHSPQ
QAQKAIEMGADYIGVGPLYPTKTKKDVCEPVTISYLDWVVSHIAIPFVAIGGIKQHNIQE
VIQHGAKCCALVSEILSAPNIPLRIQELRQAILLAHT
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcatacattcttcctggatcatctttagatgcagatctttatgcaattacagatgat
gcactttcttttaacaggtctgttatagaagttgttaaacaactattagatgctggaata
aggattatccaatatcgtgaaaaaaataagtcttcaaacagtatgcttaaggactgtata
acgatcaaaaaattaacagaagaagctaatgcatgttttattgtaaatgatcatgtagat
attgcagtactatgtaatgctgatggagtccaccttggacaggatgatctcccagttgat
aaagtacgggagcttataggaaaagaaaaaattattggactgtcaacccatagcccacaa
caggctcaaaaagctattgaaatgggcgctgactatattggtgtcggacctctctaccct
acaaaaactaaaaaagacgtatgtgaacctgttacaattagctatcttgattgggttgtc
agccatatagctattccttttgttgctattggtggtatcaagcaacataatatccaagaa
gtcattcaacatggtgcaaagtgttgcgcacttgtctcagaaattcttagtgctcctaat
atacctttacgtatacaagaattacgtcaagctatactattggctcatacatag

DBGET integrated database retrieval system