KEGG   Lawsonia intracellularis PHE/MN1-00: LI0332Help
Entry
LI0332            CDS       T00354                                 

Gene name
glgP
Definition
(GenBank) carbohydrate phosphorylase family protein
  KO
K16153  glycogen phosphorylase/synthase [EC:2.4.1.1 2.4.1.11]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00500  Starch and sucrose metabolism
lip01100  Metabolic pathways
lip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LI0332 (glgP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lip01003]
    LI0332 (glgP)
Enzymes [BR:lip01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     LI0332 (glgP)
    2.4.1.11  glycogen(starch) synthase
     LI0332 (glgP)
Glycosyltransferases [BR:lip01003]
 Polysaccharide
  Storage polysaccharide
   LI0332 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Phosphorylase DUF3417 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: CAJ54388
UniProt: Q1MRI8
Position
416124..420386
Genome map
AA seq 1420 aa AA seqDB search
MQQAVEQTTLFEVSWEVCNKVGGIYTVVTTKVPQAIKTFGDNYYLIGPNLGNNADFQETD
EPCWETLSQSLAIRSLHCRFGRWNIPGNPKVILVNFKDRYNQNQLLYEFWNRYGVDSMTG
GWDYIEPVMFGSACGEVINIAVKTLVEPVGGTAVAHFHEWMCGSGLLTIKQLAPDVGTVF
TTHATILGRSMAGAGIDIYENLSQINPQREAAAYNITAKQSMESITAREADYFTTVSEIT
ADEAEAFLGRRPDIITPNGLDLHIIADFSKDTSLTTTARQSILSRASQFIGQQLPNDTRI
MIISGRYEFHNKGFDVFLDALGNVEQALRNSNKYVLALCTAIGGHTGVTKYALENHLESN
MITPPMPLRIVTHHVYNIEQDPIITKCLRLGLTNHEEDHVKIIFVPALLNGQDGFFNMQY
EQVLPGCDLGVFPSWYEPWGYTPQESAAHAVPTVTTDLSGFGMWVRKLQENNHVTDGISV
IHRLHMPYDDTVNALQSVILEYATCSSEKLMQHRIAVRKVSEECSWEKFFPYYIQSYHSA
LAKANERISIHEPQKQTNTLVITGVSKTPNLRMLTAINQLPQKLGRLREVVNNVWWTWQP
EAETIFTLLSKELWKQSGHNPLKMLEDICPAALMAAEKNTEIQECYNELITKFDEYMKNK
PHTTDPSISSYHPIAYFSTEYGLHESIPLYSGGLGILSGDHLKAASDLNIPMVAIGLLYK
NGYFQQRIDAQGNQIAMYPENNFSLLPISLVKTLQGDPVRIELDLFPGRQLFAQVWKMQV
GHVPLYLLDTDIPQNILDDRRITARLYESDRDCRIRQEILLGMGGVRLLNLLKIMPSIYH
MNEGHSAFMILERIRNLMLWFNLPFNTAQECVRGNTVFTTHTPVDAGNERFDPSLMEKYF
SDYAKSVNLTWNDFMSLGRFSTNDRNMFEMTLLAIRNANKVNGVSRLHSQVSKHMWANNW
KGLPVPEIPIGYVTNGVHIASYVGEHTRKLLKKYVHELWDSLPTSHEAWKNVAQIPDEEL
WKARLEQKQPLLNVIKHLAMSSNLSYKIFAEEQQSIIQQLSEDVLIIGFARRFAPYKRAN
LILANPDRLHHILNNPQKPTILVFAGKAHPADQQGIDLIKQVINYTKDPRFYGKIFFIEN
YNLAIAKILLQGCDVWLNTPRRPYEACGTSGQKVGANGGLNLSIADGWWCEGYNSHNGWT
IGKEIVDILPESEQCDYSDAESLYSLLEESVLPLYFKKDTNSFSPSWIAMVKNAMQTLIP
EFNAERMLHQYLDDYYLPLAKNQVTFRGDNFAIPKQITKWKQGLEQRFATIKIRNVQIEG
LTEDTVLYGEPLTITVTLSPESMKVDELLVQLVIGPGKDNTFTEMPDVLTLMVSQQSGKE
VTFSGVYNIKYNGPNVYGIRILPTMPGLLSPYETGLILWV
NT seq 4263 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggcagttgaacaaacaacactttttgaagttagctgggaagtctgtaataaa
gtcggagggatttatacagtagtaactaccaaagtccctcaagcaataaagacttttgga
gacaattattatcttattggacccaacttaggaaataatgcagattttcaagaaacagat
gaaccttgctgggaaacattaagccaatcacttgctataagaagtcttcattgtcgtttt
ggtcgttggaatattccaggaaatcctaaggttattctagtcaactttaaagatagatat
aaccaaaatcaattattatatgaattttggaatagatatggtgtcgactctatgacagga
ggctgggactatattgaaccagttatgtttggttcagcttgtggcgaagttattaatata
gcagtcaaaacacttgtagaacctgttggtggaacagctgttgctcattttcatgaatgg
atgtgtggtagtggattactcactattaaacaacttgctccagatgtaggaacagttttt
accacacatgcaactattcttggacgatcaatggctggtgcaggcattgatatttatgaa
aatctctcacaaataaatccacaaagagaagctgctgcttataatataactgctaaacaa
tccatggaatctattactgctcgtgaggcagattacttcacaacagttagtgaaattaca
gctgatgaagcagaagcttttcttggacgtcgtcctgatattattacacccaatggatta
gatttacacatcatagctgactttagtaaggacacttctcttactacaacagcaagacaa
tccatccttagtcgagcttctcaatttattggtcaacaacttcctaatgatacacgtatt
atgattatttctggtcgatacgagtttcataataaaggatttgatgtctttcttgatgca
ctaggaaatgtcgaacaagcattaagaaactcaaataaatatgttcttgcattatgtaca
gctattggaggacatactggtgtcacaaagtatgccctagagaatcatcttgaatcaaat
atgattactcctcctatgccactccgtattgtaactcatcatgtttataatatagagcaa
gatcctattattacaaaatgtttgagattaggactcacaaatcatgaagaagaccatgta
aaaattatatttgtacctgcgcttcttaatggtcaagacggtttctttaatatgcaatat
gaacaagtactgccaggatgtgaccttggggtattcccatcatggtatgaaccatgggga
tatacacctcaagaaagtgctgctcatgccgttcctacagttacaactgatctttcaggt
tttggaatgtgggtacgtaaactccaagaaaataaccatgttacagatggtatttctgtc
atacatcggctgcatatgccatatgacgatactgttaatgcacttcaatctgttatactg
gaatatgcaacctgttcatcagaaaaacttatgcaacatcgaatagctgtgcgtaaagtc
tctgaagaatgttcatgggagaaatttttcccatattatattcaatcatatcattctgca
cttgcaaaagccaacgagcgtatcagcatacatgaaccacaaaaacaaacaaacacactt
gttattacaggtgtatcaaaaacacctaatcttagaatgcttacagcaattaaccaactt
ccacaaaaacttggacgactcagagaagttgtgaataatgtttggtggacctggcagcct
gaagcagaaaccatcttcactttactgagcaaagaactatggaaacaatcaggccataac
ccactcaaaatgcttgaagatatatgccctgcagcccttatggcagcagaaaaaaataca
gaaatacaggaatgttataacgaattgatcacaaaatttgatgaatatatgaagaataaa
cctcacacaactgatccttctatttcatcttaccatcctattgcatatttctctacagaa
tatggcttacatgagagcatcccgctctactctggtggattaggtatcctttctggcgat
catcttaaggcagctagtgacttaaacattcccatggttgctataggacttttatacaaa
aatggctatttccaacaacgaatagatgctcaaggcaatcaaattgctatgtatcctgaa
aataacttctctcttcttcctatttctcttgtaaaaacacttcaaggagatcctgttaga
atagagctagatcttttcccaggaagacaactttttgcacaagtatggaaaatgcaagta
ggtcatgtaccactctacttacttgacactgatattccacaaaatattctagacgatcga
agaattacagcacgactttatgaatcagatagagactgtagaatacgacaagaaattcta
ttaggaatgggtggtgtaagattattgaatctacttaagattatgccttctatctaccac
atgaatgaagggcactctgcttttatgattttagaaagaattcgtaacctgatgctttgg
ttcaatctaccattcaatacagctcaagaatgtgtacgtggtaatacagtatttactaca
catacacctgttgatgctggtaatgaacgatttgatcctagtttaatggaaaaatatttt
tcagattatgcaaaatctgtcaaccttacatggaatgacttcatgagtcttggcagattt
tccacaaatgatagaaacatgtttgaaatgacactccttgctattcggaatgcaaataaa
gtaaatggagttagtagattacatagccaagtctctaaacatatgtgggctaataattgg
aaaggattacctgttcctgaaatacctattggatatgttacaaacggagtacatattgca
tcttatgttggagaacatacacgaaaacttctcaaaaagtatgtgcatgaattatgggat
agcctacccacatcccatgaggcatggaaaaatgttgcacaaattcctgatgaagaatta
tggaaagctaggttagaacaaaagcagcctcttcttaatgtaataaaacatctggctatg
tcatctaacctctcctataaaatctttgcagaagaacagcagagtattatacaacagctt
tctgaagatgtacttattattggatttgcaagacgctttgctccatataaaagagctaat
cttattcttgctaaccctgacagattacaccatattctgaacaaccctcaaaaaccaaca
attcttgtttttgctggtaaagcacatccagctgatcaacaagggattgatcttataaaa
caagtaataaactatacaaaagatcctagattttatggtaaaatattctttatagaaaat
tataatcttgctattgcaaaaattcttctacaaggctgtgatgtttggcttaatactcca
cgtcggccatatgaagcatgtggtacaagtggtcaaaaagtaggtgctaatggtggactt
aatcttagtattgctgatggatggtggtgtgaaggctacaacagtcataatggttggaca
attggcaaagaaatcgtagacatattacctgaatccgagcaatgtgactatagtgatgca
gaatccttatatagccttttagaagaatctgtacttccactatattttaaaaaggacaca
aatagcttttctccttcatggatagcaatggtcaaaaatgctatgcaaacccttatccct
gaatttaatgctgaaagaatgcttcatcaatatttagatgattattatcttccacttgca
aaaaatcaggtaacctttagaggtgataactttgctattccaaaacaaattaccaaatgg
aaacaaggacttgaacaacgctttgctaccattaaaatacgtaatgtccaaattgaaggt
ttaacagaagatactgtgctttatggagaacctcttactattactgtaacgcttagtcct
gaatcaatgaaagttgatgaacttctagttcaacttgttataggtcctggaaaagataat
acatttacagaaatgccagatgtgttaacactcatggtatcacagcaatctggtaaagag
gttacattctctggagtatataatattaaatataatggacctaatgtttatggaatacgt
atcttacctacaatgccagggttactttcaccatatgaaacagggcttatcctttgggta
taa

DBGET integrated database retrieval system