KEGG   Lawsonia intracellularis PHE/MN1-00: LI0735Help
Entry
LI0735            CDS       T00354                                 

Gene name
ychB
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Pathway
lip00900  Terpenoid backbone biosynthesis
lip01100  Metabolic pathways
lip01110  Biosynthesis of secondary metabolites
lip01130  Biosynthesis of antibiotics
Module
lip_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lip00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI0735 (ychB)
Enzymes [BR:lip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LI0735 (ychB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N DUF5077
Motif
Other DBs
NCBI-ProteinID: CAJ54789
UniProt: Q1MQD8
Position
919170..920087
Genome map
AA seq 305 aa AA seqDB search
MIYSHLSSTSCTITTGCKVNLNLYITGILPNGWHKIDSIFLPLSEPHDELHIEITNHNQG
LHLSCNILDIELENNILTKTYTLFTKATHFTPSISIYLKKGIPYGAGLGGGSSDAAALLT
WLQKNSPLPLSPSKLLKLAAEIGADVPFFLKNKPCRATGIGEKLEEISLSNLNISGNTLF
IICPNLKISTPYAYKMWDDYNKKQIATSSRYNNNLTKKYSWDRSSPSTHLSDYLWMKNDF
EPVIFSEYTELSVFKEQLLQFGARAAVLSGSGSSIYGLFKEYNQTSIMTEFYKKKNILTF
SQLLQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatttattctcacctttctagtaccagttgtacgattactactggatgtaaagtaaat
cttaatctatatattacaggaattcttcctaatggttggcataaaatagactctattttt
ctaccactatctgaacctcatgatgaacttcatattgaaataactaatcataaccaaggg
cttcatctttcctgcaatattcttgatattgagttagagaataatattctgacaaaaact
tataccctttttactaaggctacacattttaccccttctatttctatatatttaaaaaaa
gggatcccttatggagctggtcttggtggtggtagctcagatgctgctgcattactaact
tggttacaaaaaaatagtccacttcccttatctccatcaaaactactaaaacttgctgct
gagattggtgcagatgtcccattttttcttaaaaataaaccttgtcgagctactggcatt
ggagagaagttagaagaaatctctctttctaaccttaatatttcaggcaatacgcttttt
attatttgtccaaacctaaaaatttcaaccccatatgcatataaaatgtgggatgattat
aataaaaaacagatagctacctcctcacgttataacaataacttgacaaaaaaatactct
tgggatagaagctcaccatccacccatctgtcagactacttgtggatgaaaaatgatttt
gagccagttatcttttctgaatacacagaattaagtgtattcaaagaacaactccttcag
tttggagcgcgagctgctgtactaagtggtagtggatcatcaatatatggcttatttaaa
gaatataaccagacgtcaattatgactgagttttataagaaaaaaaatattttaacattc
agtcagttattgcagtag

DBGET integrated database retrieval system