KEGG   Lawsonia intracellularis PHE/MN1-00: LI1050Help
Entry
LI1050            CDS       T00354                                 

Definition
(GenBank) predicted metal-dependent phosphoesterases (PHP family)
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
lip  Lawsonia intracellularis PHE/MN1-00
Brite
KEGG Orthology (KO) [BR:lip00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LI1050
Enzymes [BR:lip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     LI1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP DUF692
Motif
Other DBs
NCBI-ProteinID: CAJ55104
UniProt: Q1MPH3
Position
1293526..1294392
Genome map
AA seq 288 aa AA seqDB search
MQPYFVDLHTHTIASDGTDTPRELVIKAAKLKLAAIAITDHDTIAGLEEAEQAGRENQIE
VIRGCELGVTSKYGEIHLLGLWLPYDNISLKEMFKTLLKDRHDRAKLIISKLNKLGYNIS
YEEIIANIPGEAIGRLHIAQHLTQKGYFVDTKEAFKSCLGHNGLAYIPKTTISLKEGVRV
LVDAGAMVSFAHPMLLRCPKDWLEDTIVMLKDYGLSAIEAYHSEHSQKDERYCVDLASRY
QLGITGGSDYHGSGKSNVKLGRGRGGVRMTLAMLDVLKERHFRINQTI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccttactttgttgatttacatacacatacaatagcttctgatggaacagataca
cctagagagttagtcataaaagctgcaaagttaaagcttgctgcaatagctattacagat
catgatactattgcaggtttagaagaagctgaacaagcagggagagaaaatcaaattgaa
gttattcgtggatgtgagctaggtgttacaagtaaatatggagagattcatttacttgga
ttatggttaccttatgataatatcagtcttaaagaaatgtttaaaacattacttaaagat
cgacatgaccgggctaaattaatcataagtaaacttaataaactaggctataatataagt
tatgaagaaattatagcaaatattcctggtgaagctataggacgtctacacattgcacaa
catttaacccaaaaaggttattttgttgatacgaaagaagcatttaagtcctgtcttgga
cataatggtttagcttatattccaaagacaacaatatctttaaaagaaggggttcgtgta
ttagtagatgctggagcaatggtaagttttgctcatcctatgctactaagatgtccaaag
gattggcttgaagatactattgttatgcttaaagactatggtctttctgctattgaagct
tatcatagtgagcattcacaaaaagatgagcgatactgtgttgacttagcaagccgatat
cagcttggaatcacaggtggctcagattatcatggatcaggtaaatctaatgtaaagtta
ggtagaggccgtggaggagttcgcatgacattggctatgttagacgttttaaaagaaaga
cattttagaattaatcaaactatataa

DBGET integrated database retrieval system