KEGG   Lawsonia intracellularis N343: LAW_00935Help
Entry
LAW_00935         CDS       T02437                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lir  Lawsonia intracellularis N343
Pathway
lir00860  Porphyrin and chlorophyll metabolism
lir01100  Metabolic pathways
lir01110  Biosynthesis of secondary metabolites
lir01120  Microbial metabolism in diverse environments
Module
lir_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:lir00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LAW_00935 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lir01007]
    LAW_00935 (hemL)
Enzymes [BR:lir01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     LAW_00935 (hemL)
Amino acid related enzymes [BR:lir01007]
 Aminotransferase (transaminase)
  Class III
   LAW_00935 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Methyltransf_34
Motif
Other DBs
NCBI-ProteinID: AGC50330
Position
complement(1132195..1133487)
Genome map
AA seq 430 aa AA seqDB search
MQEESSKELYSKAVKLIPGGVNSPVRACRNVGCEPVFIESAKGAYLTTVDGQELLDFVLS
WGAIILGHTNSTVTNAIKKAASNGTTFGAPCKAEVLLAKEIIDAFPGMDMIRMVSSGTEA
TMSALRLARGVTGRNKVLKFIGCYHGHADPFLASAGSGVATLSIPGTPGVPEVTVRDTLL
APYNDLSTVKDLFVMYGKDLAAVFVEPIAANMGLIPPKEGFLKGLRALCDAHGTLLIMDE
VITGFRVAYGGAQTRFDITPDLTTLGKIIGGGLPIGAYGGKAKYMEHIAPLGEIYQAGTL
SGNPLVMTAGFETLQLLKDINYTILEKQVATFANELEVILKDKGVPVQVSNFASMFTVFF
TNNELKSFDDVKTTNTQLYSILFRSMQKNNIFLVPSPFETNMVSFAHKEKEFEKALIAAK
KIMFNITDVN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagaagaatcttcaaaagaactttattccaaagctgtaaaacttatacctggagga
gtaaatagtcctgtaagagcttgccgaaatgtaggatgtgaacctgtctttatagagtcc
gctaaaggagcatatctcactacagtagatggtcaagaattattagactttgttctttct
tggggagcaattattcttggtcatactaattctactgtaacaaatgctataaaaaaagca
gcttcaaatggaacaacctttggtgcaccatgtaaagctgaagtactattagctaaagaa
attattgatgcattccctggaatggatatgattcgtatggtaagctctgggacagaagct
actatgagtgctctacgtcttgcgagaggtgttacaggacgtaataaggtattaaaattt
attggttgttaccatggtcatgcagatccttttttagctagcgcaggctctggagttgcg
acactatctatccctgggactccaggagttcctgaagtcactgttcgagacactctctta
gctccatataatgacttaagtacagtaaaagacttatttgttatgtatggtaaagatctt
gctgctgtatttgtagaacctatagctgcaaatatggggcttatacctcccaaagaaggt
tttctaaaaggccttcgtgcattatgtgatgctcatggaacactcctcattatggatgaa
gtaattacaggttttcgtgttgcatatggaggagcacaaactcgttttgatataactcca
gatctcacaacattaggaaaaattattggtgggggactacctataggtgcatacggagga
aaagcaaaatatatggagcatattgcaccattaggagaaatctaccaagcaggaacatta
tcaggaaatcctcttgtcatgactgcaggatttgaaacattacaacttcttaaagatata
aattatacaatacttgaaaaacaggttgctacttttgctaacgagcttgaagtaatcctc
aaagacaaaggtgtccctgtacaagtatcaaattttgcatctatgtttacagtttttttt
acaaataatgaattaaaaagttttgatgacgtaaaaacaactaatacacaattatatagt
attctttttcgttcaatgcaaaaaaataatatttttcttgttccttcaccatttgaaaca
aatatggtatcttttgcacataaagaaaaagaatttgaaaaagctcttattgcagccaaa
aaaataatgtttaatataactgatgttaattaa

DBGET integrated database retrieval system