KEGG   Lawsonia intracellularis N343: LAW_30005Help
Entry
LAW_30005         CDS       T02437                                 

Definition
(GenBank) dTDP-6-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lir  Lawsonia intracellularis N343
Pathway
lir00521  Streptomycin biosynthesis
lir00523  Polyketide sugar unit biosynthesis
lir01130  Biosynthesis of antibiotics
Module
lir_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:lir00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LAW_30005
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LAW_30005
Enzymes [BR:lir01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LAW_30005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AGC50677
Position
p3:5146..5688
Genome map
AA seq 180 aa AA seqDB search
MEVEKTSLEGVLLIKPKVWEDSRGYFLETWNKQRYIEIGLQLPFVQDNHSSSTLHTLRGL
HFQQQYPQGKLVSVSLGEVFDVAVDLRINSPTFGSWFGVILSEKNHYQMWIPPGLAHGFC
VLSERAHFHYKCTEYYYPQDESCICWNDPDIGIDWPVQHPNLSHKDKIAQSWADYVASIT
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggaaaagacgtctttagaaggcgtattactgattaaaccaaaagtatgggaa
gacagccgaggatactttctagagacatggaataaacaacgctatattgaaattggacta
caactaccctttgttcaggacaatcattcttcttcaacgcttcatacacttagaggtctt
cactttcaacaacagtatcctcaagggaaacttgtaagtgtctcattaggagaagttttt
gacgttgctgtagatcttcgtataaattctcctacctttggatcatggtttggtgtgatt
ctttcagagaagaatcattatcaaatgtggattccaccaggcttagctcatggtttctgt
gttctttcagaacgtgcccattttcactataaatgtacggaatactattatccacaagat
gaaagctgtatttgctggaatgatccagacattggtattgattggcctgtacagcatcca
aatctttcacacaaagataaaatagctcaatcttgggcagattatgttgcttctataaca
tag

DBGET integrated database retrieval system