KEGG   Leptospira interrogans serovar Linhai: LIL_10968Help
Entry
LIL_10968         CDS       T03859                                 

Gene name
btuE1
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lis  Leptospira interrogans serovar Linhai
Pathway
lis00480  Glutathione metabolism
lis00590  Arachidonic acid metabolism
lis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    LIL_10968 (btuE1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LIL_10968 (btuE1)
Enzymes [BR:lis01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LIL_10968 (btuE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Flp_C
Motif
Other DBs
NCBI-ProteinID: AJR13570
UniProt: A0A0C5X1A5
Position
1:1107474..1108043
Genome map
AA seq 189 aa AA seqDB search
MKEGASFMYSKYFIWFMTLGIFLPLAGIFAKGSFYDFKVKDIKGNEVSLSKYKGKVVMVV
NVASKCGYTYQYEHLEKVYKKYKDQGFAVVGFPANNFGGQEPGTDQEIETFCRIQKGASF
DMMSKISVKGKDIHPLYSYLIQNSPNPGEVEWNFEKILISKSGTIEARYRSSVEPDSSAV
TQKIETLLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaggagccagttttatgtattcaaagtatttcatttggtttatgactttagga
atttttttaccattagcggggatttttgcaaagggaagtttttatgatttcaaagtaaaa
gacatcaaaggaaacgaagtgtctctttctaaatataagggaaaggtagtgatggtggtg
aacgtagcttctaaatgtggttatacctatcaatacgaacatctcgaaaaagtttataaa
aaatataaggatcaaggatttgcagtagtaggttttcccgctaataattttggaggccaa
gaaccaggaaccgatcaagaaatcgaaacgttttgcagaattcaaaaaggtgcaagtttt
gatatgatgtctaaaatttcagtcaaaggaaaggacattcatcctttatattcttatctg
attcaaaattctccaaatccgggagaagtagaatggaacttcgaaaaaattttaatatca
aaaagtggaacaatagaagcgagataccgttcttctgttgagcctgatagttccgcagtg
actcaaaaaattgaaactctcttaaagtga

DBGET integrated database retrieval system