KEGG   Leptospira interrogans serovar Linhai: LIL_12877Help
Entry
LIL_12877         CDS       T03859                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lis  Leptospira interrogans serovar Linhai
Pathway
lis00471  D-Glutamine and D-glutamate metabolism
lis00550  Peptidoglycan biosynthesis
lis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lis00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LIL_12877 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LIL_12877 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lis01011]
    LIL_12877 (murD)
Enzymes [BR:lis01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     LIL_12877 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:lis01011]
 Precursor biosynthesis
  Amino acid ligase
   LIL_12877 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AJR15479
UniProt: A0A0C5WTA4
Position
1:3452054..3453445
Genome map
AA seq 463 aa AA seqDB search
MKFPESLKGLKILVLGGGISGNSALNFLISEKAQPILCDQNQPERTVVPFFPDNIPPQSL
PEVSLVIKSPGILPTHPILSYAADKKIPVVSEIDLGRYFFKGKIIGITGTDGKSTTTSLI
AHLLKESFPDLKEGGNLGIPFTSFCKESISLAVLELSSYQLEDSSPLHLDVSVFLNLASD
HLERHKTMENYFQAKLKIADLSNSNHTLIVSEKIKERILNSISYQCKLLSFGKTSDSNAF
LDENSLKIKTSKFVYDISKFYLPGTHNRENLAASILAAEEIGGKPESIQTRIPLFRGLPH
RFQIAGEKLGISFINDSKSTNLHSMLAGMATWKNIDQTCLILGGRPKQEDLKPLYNFLIR
GIGCVVLFGEARVAWESGIKNIIGEKLYCVENLNDTFEIFKKGNIFPIPGLNKDIIIRLS
DSISISSFVFSPACASFDQYKNFEERGNHFLSLVNDFLDQIDS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttccagagtccttaaaaggcctaaaaattctcgttttagggggaggaatctcc
ggaaactcggctcttaattttttaatttccgaaaaagcccagccgattctttgcgatcaa
aatcaaccagaaagaaccgttgttcccttttttccagataatattccccctcagtctctt
cctgaagtttcattggttattaaatctcctggaattttaccaactcatccaattctttct
tatgctgcggataaaaaaattccggttgtatctgagattgatttaggaagatattttttt
aaaggaaaaattataggcattaccggaaccgacggtaaatctactacaacttctttaatt
gcgcaccttttgaaagaaagttttcccgatctaaaagaaggtggaaatttaggaattcct
tttacctctttttgtaaagaatccatttccctggccgttctagaactctctagttatcaa
cttgaagattcatctcctcttcatctggatgtgtccgtttttctgaatcttgcttctgat
catttagaaagacacaaaacgatggaaaattatttccaagctaaacttaaaattgcggat
ctatctaattcaaatcatactttgatagtttctgaaaaaatcaaagaaagaattttaaat
tctatttcttatcagtgtaaacttcttagtttcggaaaaacttccgattcaaatgcattt
ttagacgaaaactctttgaaaatcaaaacctcaaagtttgtatacgacatctctaagttt
tatcttccaggaactcataatagagaaaatctcgctgcgtccattctcgctgcagaagaa
attggtggaaaaccagaatcaatccaaactaggattcctctttttagaggtttacctcat
cgttttcaaatcgctggagaaaaattaggaatttcgtttattaacgattctaaatcaacg
aacttacatagtatgctcgcgggaatggctacttggaaaaatatagatcagacttgttta
attttaggcggtagacctaagcaagaagacttaaaaccactttacaattttctaatcaga
ggaattggctgtgtagttttatttggagaggccagggtcgcttgggaaagtggaattaaa
aatataatcggagaaaagctctactgcgttgaaaatctaaatgatacttttgaaatattc
aaaaaaggaaatatatttcccatccccggtttaaacaaagatataataattcgtctttcc
gatagcatttcaatttcctcttttgttttttctccggcttgtgcaagttttgatcaatat
aagaatttcgaagaaaggggaaatcattttctttccctagtgaatgattttctagaccaa
attgattcttaa

DBGET integrated database retrieval system