KEGG   Litoreibacter sp. LN3S51: FPZ52_01285Help
Entry
FPZ52_01285       CDS       T06129                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lit  Litoreibacter sp. LN3S51
Brite
KEGG Orthology (KO) [BR:lit00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FPZ52_01285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QDY70191
UniProt: A0A5B8IZ46
Position
complement(236511..237887)
Genome map
AA seq 458 aa AA seqDB search
MSVALAFLILTGLVAFLLVGQRPDSFVVIAAAIFGAYMALNIGANDVANNMGPAVGANAL
TMGGAIVIAALCESAGALLAGGDVVGTISKGIIDPASLADPNVFVWAMMAALVSSALWVN
LATIIGAPVSTTHSVVGGVLGAGATAAGLSAVDWNTMQAIAASWVISPLMGGVIAAATLA
FIKVYVIYQDDKIAAARRWVPVLIGIMAGAFTTYLLLKGLKAILTVSPLASLALGIMVGA
LSYAVAAPLIRMQSEGMENRNKSLKSLFSFPLVLSAGLLSFAHGANDVANAVGPLAAIAN
VVQEGHTTMDMQEIPTWVMVVGALGISFGLMLFGPKLIRMVGSQITKLNPMRAYCVALSA
AITVIIASWLGLPVSSTHIAIGGVFGVGFFREWFLERRARQFAQQSGRNKVIAPEERRRR
KLVRRSHFLTIVAAWLITVPASALLSSGVFLVLRALAI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgcgcttgccttcttgattctgacgggtctcgtcgccttcttgctcgtcggc
cagcgcccggattcattcgtcgtgatcgccgcagccatcttcggcgcgtacatggcgctg
aacatcggggccaatgacgtcgctaacaacatgggtccggcggtaggcgccaacgcgctt
accatgggcggcgctatcgtcatcgcggctttgtgcgagagcgccggtgccctgctggcc
ggcggcgacgtggttggaacgatttccaaaggcatcatcgatccagccagtctcgccgat
cccaacgtctttgtctgggcgatgatggcggcactggtatcgtccgcattgtgggtcaat
ctggcgacgataatcggagcacccgtttcaaccacccattccgtggtcggcggtgttctg
ggtgcaggagcaaccgccgcagggctttcagccgtcgattggaacaccatgcaggccatc
gcggcaagctgggtgatctcgccgttgatgggcggtgtgatcgctgctgcaacgcttgcc
ttcatcaaggtctacgtcatctatcaggacgacaagatcgccgccgcgcgtcgctgggtg
ccagtgcttatcggcatcatggctggtgcctttaccacatatctgttgctgaagggcttg
aaggccatcctaacggtttcccctctcgcgtcgcttgccttgggcattatggttggcgcg
ctttcctatgccgtcgcagctcctttgattcgtatgcagtcggaagggatggaaaaccgc
aacaaatccctcaagagcctgttttcgttcccgcttgttctgtccgccggcctgctgtcg
ttcgcgcatggtgccaatgatgtcgcgaatgcggtcggccccttggcggcaattgcgaat
gtcgttcaagagggtcacaccacgatggacatgcaggaaatcccaacatgggtcatggtt
gtcggggctctcggtatttccttcggcttgatgctgttcggccccaagctgatacgcatg
gttggcagccagatcacaaagctgaacccaatgcgtgcttattgcgtagccctttctgcg
gctattaccgtcataatcgcgagttggcttgggctgcccgtcagttccacgcatatcgcg
attggcggtgttttcggtgtgggctttttccgagaatggttcctggaacgccgcgcgcgc
caatttgcccagcaatccggccgcaacaaggtaatcgcacctgaagaacgccggcgccgc
aaactggtgcgccggtcacattttctgaccattgtagccgcatggctgatcacggtacca
gcgtcggcgcttctgtcgtccggcgtattcttggtgttgcgggcgctggcgatctga

DBGET integrated database retrieval system