KEGG   Litoreibacter sp. LN3S51: FPZ52_17620Help
Entry
FPZ52_17620       CDS       T06129                                 

Definition
(GenBank) NAD(P)-dependent oxidoreductase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
lit  Litoreibacter sp. LN3S51
Pathway
lit00053  Ascorbate and aldarate metabolism
lit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    FPZ52_17620
Enzymes [BR:lit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     FPZ52_17620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 NAD_binding_10 Polysacc_synt_2 KR adh_short Ldh_1_N DUF1854
Motif
Other DBs
NCBI-ProteinID: QDY71496
UniProt: A0A5B8ICZ4
Position
unnamed4:241570..242364
Genome map
AA seq 264 aa AA seqDB search
MKRLLITGAAGGLGSVMRTKLAHLADTVRLSDVADMGTSASNEELVECDLSDEQAVNELV
EGCDGIVHFGGVSIERPFRQIMAGNIHGVYNLYEAARAHGMPRIVFASSNHTIGFHTQDT
HLQADCVTKPDSLYGVSKCFGESMASMYHSKFGQETAIVRIGSSFEKPTNHRMMATWFSY
DDFTRLIERVFSVRKLGCPIIWGVSANDEHWWDNSQASFLGWVPKDNSEIFREEIEARNE
RPDADSSQSRWQGGHFCDEPIYKD
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacttcttataacgggcgcagcaggcgggttgggaagcgtcatgcggaccaaa
ctggctcatctggcggatacagtgcgcttgtctgatgtcgcggatatgggaacctccgcc
agcaatgaagagctggtcgaatgcgacctgtcggacgaacaagcggtcaatgaattggtc
gaaggctgtgacggaatcgtccatttcggaggggtgtcgattgagcgtccgttccgccaa
atcatggccggaaacattcatggtgtttacaatttgtatgaagcggcccgcgctcatgga
atgccgcggatcgtttttgcttcttcaaaccatacgatcggttttcacactcaggataca
cacctgcaggcggactgtgtgacaaagccggactcgctttatggtgtgtcgaaatgcttc
ggtgaatccatggcgtcgatgtatcattccaagttcgggcaagagacggccattgtgcgt
attggttcgagcttcgagaaaccgaccaaccaccgcatgatggcgacatggttcagctac
gatgattttacccgattgatcgagcgcgtgttcagtgttcggaagttgggttgcccgatc
atctggggtgtatcggccaatgacgagcattggtgggacaactcgcaggcgtctttcctt
ggctgggtgcccaaggacaactccgagattttccgtgaggagatcgaggccagaaacgag
cgccctgacgcagatagttcacagtctcgttggcagggcggccatttttgcgacgagccg
atctacaaggactaa

DBGET integrated database retrieval system