KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_1373Help
Entry
LIV_1373          CDS       T01623                                 

Definition
(GenBank) Putative Acetyl-CoA:acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00071  Fatty acid degradation
liv00072  Synthesis and degradation of ketone bodies
liv00280  Valine, leucine and isoleucine degradation
liv00310  Lysine degradation
liv00362  Benzoate degradation
liv00380  Tryptophan metabolism
liv00620  Pyruvate metabolism
liv00630  Glyoxylate and dicarboxylate metabolism
liv00640  Propanoate metabolism
liv00650  Butanoate metabolism
liv00900  Terpenoid backbone biosynthesis
liv01100  Metabolic pathways
liv01110  Biosynthesis of secondary metabolites
liv01120  Microbial metabolism in diverse environments
liv01130  Biosynthesis of antibiotics
liv01200  Carbon metabolism
liv01212  Fatty acid metabolism
liv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LIV_1373
   00630 Glyoxylate and dicarboxylate metabolism
    LIV_1373
   00640 Propanoate metabolism
    LIV_1373
   00650 Butanoate metabolism
    LIV_1373
  Lipid metabolism
   00071 Fatty acid degradation
    LIV_1373
   00072 Synthesis and degradation of ketone bodies
    LIV_1373
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LIV_1373
   00310 Lysine degradation
    LIV_1373
   00380 Tryptophan metabolism
    LIV_1373
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LIV_1373
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LIV_1373
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LIV_1373
Enzymes [BR:liv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LIV_1373
Exosome [BR:liv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LIV_1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBW85854
UniProt: G2Z8F9
Position
complement(1434384..1435553)
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAARTPIGKFGGSLKDISAVELGTTVVKGLLERANISPEEVDQVIFGNVLQSG
LGQNVARQIAINAGIPYQVPGVTINEVCGSGLKSIMFGKQAIQLGEAEIVVVGGTENMSQ
APLLLNPELVEEEVNPKNLKNSMLIDGLTDVFGEYHMGITAENVAKKFAVSREEQDAFAH
NSQMKAAKAQEKNLFEDEIIPVQLADGSFFNKDETIRANSTLEKLATLKSAFKEDGTVTA
GNASGINDGASAIILMSKEKAIAEKIPYLATIKITSEVGVDPAIMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPENKLNIYGGAIALGHPIGASGARIVVSLLN
ELKHENKRTGLASLCIGGGIGIAMVVERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgccgctcgcacaccaattggaaaatttggtggaagt
ttgaaagacataagtgcagtagaattaggaacaactgttgtaaaaggacttttagaaaga
gctaatatttcgcctgaagaagtagatcaagttatttttggtaatgtgttacaatctggt
cttggccagaatgtagctcgacaaatcgctattaatgcaggaattccttatcaagttcct
ggtgtaactattaatgaagtttgtggatctggtttaaagtccattatgtttggtaaacaa
gcaatccaactaggagaagcagaaattgttgtagtcggagggactgaaaacatgtcccaa
gcaccattactgcttaatcctgaattagtagaggaagaagtcaatcctaaaaatctgaaa
aatagtatgttaatcgatggtttaactgatgtgtttggtgaataccatatggggattacc
gctgaaaacgttgcaaaaaagtttgctgtgtctcgtgaagaacaagatgccttcgcacat
aactcgcagatgaaagcagcgaaagcccaagaaaaaaatctttttgaggatgaaattatt
ccagtacaattagcagatgggtcttttttcaacaaagatgaaaccattcgtgctaattcg
actttagaaaaacttgctacactgaaaagcgcttttaaagaagacggaacagtgacagca
gggaacgcatccggtattaacgacggtgcttctgccattattttaatgtctaaagaaaaa
gccatagcagaaaaaattccttatttagcaaccatcaagatcacatcagaagttggtgtt
gatcctgctattatgggatatgcgccttattatgcagtaaatgaagctttaacaaaaggc
ggctacagcatagacgaaatagacttattccaccttaatgaggcttttgcttctcaatca
gttgctgttgcaagagatttaaaaattccagaaaacaaattaaatatttatggcggcgct
attgcgttaggacacccaatcggtgcatctggagctcgcattgtcgtatcattattaaat
gagttaaaacacgaaaacaagcgcactggtctagcctcgttatgtattggtggcgggata
ggtattgcaatggttgttgaaagagcatag

DBGET integrated database retrieval system