KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2383Help
Entry
LIV_2383          CDS       T01623                                 

Definition
(GenBank) Putative aldose 1-epimerase (mutarotase)
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00010  Glycolysis / Gluconeogenesis
liv00052  Galactose metabolism
liv01100  Metabolic pathways
liv01110  Biosynthesis of secondary metabolites
liv01120  Microbial metabolism in diverse environments
liv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIV_2383
   00052 Galactose metabolism
    LIV_2383
Enzymes [BR:liv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LIV_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CBW86881
UniProt: G2ZFC3
Position
complement(2528424..2529494)
Genome map
AA seq 356 aa AA seqDB search
MIFIEVQKQYFGELKGETVWQWTLINDQGMKMSVLNYGAIVTSIETADKLGEFANVSLGF
SNLDDYLAYSPYFGAVVGPVAGRITKGQFHLDGEEFQLSQNNGNNSLHGGKTNFSKRIWD
VGVEEEPNQVVMTFRYQWPDGENGYPGKIDTKMSYTLNNKNEWLIDYEAETEKPTIYNPS
HHIYFNLTGENGSTVLEHQLKVNSEQFLPVDAETLPIGGIWSVKDSVFNLQTGNEIAEIT
SSADEQIKIVGTGLDHAFILKHENKKPDVVLFDPKSGRCVEMETTSDAVVVYTANSLASK
FEIDGMPVPKYAGITMETQGLVDAINQQGFGDIVLRPGERFKSRTTFRFTVDRRNI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgattttcatcgaagtacaaaaacaatattttggcgagttaaaaggcgagactgtttgg
cagtggacgttaataaatgaccaaggaatgaaaatgagcgttttaaattatggagcaata
gttacttcaattgaaactgctgataaattaggtgagtttgcaaatgttagtctgggcttt
tcgaatttggatgattatttagcttattcaccttattttggcgccgtggttggtcctgtt
gctggacgaattacaaaaggtcaatttcatttggatggtgaagagtttcagttgtcacaa
aataatggcaataattcgcttcatggtgggaaaacaaattttagtaaaagaatatgggat
gtaggtgtagaggaagaaccaaatcaagttgtcatgacatttcggtatcagtggccagac
ggagagaatggctatcctggaaaaatagatacaaaaatgagttacacgctaaacaacaaa
aacgaatggctaattgattatgaggcagagactgaaaagccaactatttataacccaagc
catcatatttactttaaccttactggagaaaatggctccacagttttagaacatcaactt
aaggttaacagtgagcaatttttacctgtagatgctgaaacgctcccaattgggggaatt
tggtcagtgaaagattctgttttcaatctacagacgggaaatgaaattgctgaaattact
agtagtgctgacgagcaaataaaaatagtaggaacagggcttgatcatgcttttatttta
aaacatgaaaataaaaagcctgatgtggttttatttgatcctaaatcaggtagatgtgta
gaaatggagacaacctcggatgcggttgtagtctatactgcaaatagtttggcaagtaaa
tttgagattgatggaatgcccgtgccaaaatatgctggaataacgatggaaacacaaggc
ttagtggatgcgattaatcaacagggatttggtgatattgttctaaggccaggagagagg
ttcaagtctagaactactttccgttttacagtggatagacgaaatatatag

DBGET integrated database retrieval system