KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2675Help
Entry
LIV_2675          CDS       T01623                                 

Definition
(GenBank) Putative acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00010  Glycolysis / Gluconeogenesis
liv00620  Pyruvate metabolism
liv00640  Propanoate metabolism
liv00680  Methane metabolism
liv01100  Metabolic pathways
liv01110  Biosynthesis of secondary metabolites
liv01120  Microbial metabolism in diverse environments
liv01130  Biosynthesis of antibiotics
liv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:liv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIV_2675
   00620 Pyruvate metabolism
    LIV_2675
   00640 Propanoate metabolism
    LIV_2675
  Energy metabolism
   00680 Methane metabolism
    LIV_2675
Enzymes [BR:liv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LIV_2675
Lipid biosynthesis proteins [BR:liv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LIV_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBW87177
UniProt: G2Z986
Position
2813886..2815463
Genome map
AA seq 525 aa AA seqDB search
MNSENLLAPELYNITDEIAKFSSEKTALIWRNEHDETKTWSYRHLLEQANKFANVAKDAG
VKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKINDIPSVAKKIIVGEKLAGWDHYETLMEQASVEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLNLLSEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTDDLVHELQ
TFTKEQTAPYKYPRRIEFASALPKTDSGKIRRVELRDAEFASVHK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagagaacctacttgctccagaactttataatattaccgacgagattgctaaa
tttagttctgaaaaaacagctttaatttggagaaatgaacacgatgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaataagtttgcgaatgttgcgaaagatgccggc
gtaaaaaaaggcgatcatgttatcgtaatgactcctcgcttgctcgaaacatatgcgatt
tatatgggcctatggaaagctggagccatcattattcccgcttccgaattacttaaagca
cacgatttagaataccgcatccatcatgctaatgtgaaagcaattgtttcttataacgga
atgactgctgaatttgataaaattaacgacatcccatctgttgccaaaaagattattgtt
ggcgaaaaattagctggttgggatcattatgaaacattaatggaacaggcttcagtagaa
ttcgaacgggtggaaacttcccgcgatgatgcatgcttacttgctttcactagtggaaca
acaggtaatcctaaaggcgttgtacatattcatggttggggttacgcgcatattcgtatc
gcagccgatcactggctagacattcatgaagacgatattgtctgggcaactgcaggaccc
ggctggcaaaaatgggtctggtctccattcctatccgttcttggaaaaggcgcgactggt
ttcatttataatggccgcttcattcctgaaaaacaactcaacctgcttagcgaagaaaaa
atcaacgtcctatgctgtacgccaacagaatatcgcttaatggcaaaagtaaataatttg
cgcgaacatgatttaagttcccttcgcagtgctgtttcagcaggtgagccactaaaccgt
gaagtaattcaagttttccaagacaattttgacattaaagttcgtgatggttatggacaa
acagaaagcacattattgattggaacgcttgtagatacgccaattcgccccggttcaatg
ggcaaaccaattatgcctgagtatatggcgattattgatgctgatggaaatccggttggt
gttggtgaaatcggtgatattgcaatgcgtagagatttcccagcattgtttaaagaatac
tataaagaacctgaacgccttcaaaaagcgattcgcggtgactattttgtttctggcgac
cgtgcaattcgtgatgaggataattactactggttccaaggtcgaaatgacgatattatt
attagctctggttacacgattggaccttttgaagtggaagacgccttgactcatcaccct
gctgtgaaagaagtagctgttgtcgcaagccctgatgaaatccgcggcaccgtcgtaaaa
gctttcatcgtcttaaaagatggttacgagggcacagacgaccttgttcacgagctgcaa
acatttactaaggaacaaactgctccatataaatatccgcgccgtatcgagtttgcaagc
gctctgccaaaaactgattctgggaaaattcgtcgtgtggaattacgtgatgctgaattt
gcaagtgtgcataaataa

DBGET integrated database retrieval system