KEGG   Listeria ivanovii WSLC3009: AX25_01005Help
Entry
AX25_01005        CDS       T03045                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
liw  Listeria ivanovii WSLC3009
Pathway
liw00450  Selenocompound metabolism
liw00970  Aminoacyl-tRNA biosynthesis
liw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AX25_01005
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AX25_01005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:liw01007]
    AX25_01005
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:liw03016]
    AX25_01005
Enzymes [BR:liw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AX25_01005
Amino acid related enzymes [BR:liw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AX25_01005
Transfer RNA biogenesis [BR:liw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AX25_01005
 Prokaryotic type
   Other AARSs
    AX25_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART DUF2724
Motif
Other DBs
NCBI-ProteinID: AHI54763
Position
213079..215073
Genome map
AA seq 664 aa AA seqDB search
MPEEKNTFYITTPIYYPSGKAHIGHAYTTVAGDAMARYKRLKGYDVFYLTGTDEHGQKIQ
AKAKERGISEQEYVDEIAEGFQELWKKLEISNTDFIRTTQDRHKTSVAKIFEQLVEQGDI
YLGEYEGWYSVSDEEYFTETQLEEVYKDENGKVIGGKAPSGNEVELVKEESYFFRMSKYA
DRLVEYYNSHPEFILPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGNPKHVVYVWI
DALSNYITALGYNTDNDTKFQKYWPADVQIVGKEIVRFHTIYWPIMLMALDLPLPKMVFG
HGWILMKDGKMSKSKGNVVDPYMLIDRYGLDALRYYLLREVPFGSDGLFTPEDFVDRVNY
DLANDLGNLLNRTVAMINKYFDGEIPAYQGKVTPFDKTLVDFKNSVVLDYEKSMDHMQFS
VALNQLWSLISRTNKYIDETAPWAIAKEEEKRAELASVMTHLAENLRIIAVLLQPFLTRT
PGEIFLQLGLQEENLKKWDSIYGYGEIPAGTTVVKKGTPIFPRLDAKEEVAFIQDEMKGS
APAPSEATAEVDALETPQIGIEDFDKVDLRVAEVKQVEKVKKADKLLCFQLDLGEGKLRQ
VLSGIAEFYEPEDLIGKKVIVVSNLKPVKLRGLMSEGMILSGEKDGKLSIIEASSTLPNG
AKVK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaagagaaaaatactttttacattacaacaccaatctattatccaagcggaaaa
gcacacatcggacatgcttatacgacagttgcgggggacgcaatggctcgctacaaacgc
ttaaaaggatatgatgtgttttacttaactggaacggatgaacatggtcaaaaaatccaa
gctaaagcaaaagaacgcggtatttctgaacaagaatacgtggatgaaattgcagaaggc
ttccaagagctttggaaaaaactagaaatttccaacacagactttattcgtacaacacaa
gaccgtcataaaacatctgttgcgaaaatttttgaacagcttgtcgaacaaggagacatt
tacttaggtgaatatgaaggttggtattctgtttctgatgaagaatactttactgaaacg
caattagaagaagtatataaagatgagaacggcaaagtcatcggcggaaaagctcctagt
ggaaatgaagtggaacttgttaaagaagagtcttactttttccgtatgagtaaatacgcg
gatcgtttagtagagtattacaattcgcatccggaatttattttaccagaatcaagaaaa
aatgaaatgataaataacttcatcaaaccaggtttggaagatttagcagtatctagaacc
acttttgactggggaattaaagttcctggcaatccaaaacatgtggtttacgtatggatt
gatgcgctttctaactatattacggcgcttggttacaataccgataatgatacgaagttc
caaaagtactggccggcagatgtccaaattgttggaaaagaaattgttcgtttccatacg
atttattggccaattatgttgatggcactagatttaccacttccaaaaatggtatttggt
catggttggattttgatgaaagatggtaaaatgtcgaagtcaaaaggaaatgtagtagat
ccatatatgttgattgatcgttatggtcttgatgcgcttcgttattatttattacgtgaa
gttccatttggttcagatggtttattcacacctgaagactttgttgaccgagtgaattac
gatcttgctaatgacctaggaaacttgctaaatcgtacggttgcaatgattaacaaatat
tttgatggagaaattcctgcttatcaagggaaggtgacgccatttgataaaaccttagtt
gatttcaaaaatagtgtcgttcttgactatgagaaaagcatggatcatatgcagttttct
gtagcacttaatcagctttggtcccttatttcccgaacaaataaatatatcgatgaaaca
gctccatgggctattgcgaaagaggaagaaaaacgtgcagaattagcgagtgtcatgact
catttagcagaaaacttacgaattatcgctgttcttttgcaaccattcttgacaagaact
cctggtgaaatcttcttacagcttggtttacaagaagaaaacttgaagaaatgggatagc
atttatggctacggagaaatccctgctggaacaactgtagtgaaaaaaggaacgccaatt
ttcccaagattagatgcaaaagaagaagtagccttcattcaagacgaaatgaaaggttca
gcaccagcaccatctgaggcaacagctgaagtggatgcacttgaaactccgcaaattggc
attgaagacttcgataaagtagatctccgagttgctgaagtgaaacaagtggaaaaagtg
aaaaaagccgacaaactactttgtttccaattagatctaggtgaaggtaagttacgccaa
gtactttctggtatcgcagaattttacgaaccagaagacttaattggcaaaaaagtaatc
gttgtttccaatttgaagccagtaaaacttcgcgggcttatgagcgaagggatgattctt
tctggtgagaaagatggaaaacttagcattattgaagcaagcagtacccttccaaatggt
gcaaaagtaaaataa

DBGET integrated database retrieval system