KEGG   Lotus japonicus: Lj0g3v0068519.3Help
Entry
Lj0g3v0068519.3   CDS       T04348                                 

Gene name
Lj0g3v0068519.3
Definition
(Kazusa) -
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
lja  Lotus japonicus
Pathway
lja00760  Nicotinate and nicotinamide metabolism
lja01100  Metabolic pathways
Module
lja_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Lj0g3v0068519.3 (Lj0g3v0068519.3)
Enzymes [BR:lja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Lj0g3v0068519.3 (Lj0g3v0068519.3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     Lj0g3v0068519.3 (Lj0g3v0068519.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
AA seq 140 aa AA seqDB search
MDVPLPLDKLALELISNETSPGNTSNSKIYAILVATGSFNPPTFVHLRMFELARDVLNSK
GYCVIGGYMSPANDAYKKKNLISAEHRIRLCNLACKSSEFVMVDPWEANQSTYQRTLTVL
SRVHGSICETGLRLYAEIME
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggatgttcccttgccattggataaattagctttagaactgattagtaatgaaacctcc
cctggaaacactagcaacagcaagatatatgcaattctggttgcaactggaagctttaat
ccgcctactttcgtgcatttacgcatgtttgagcttgcaagagatgtgttgaattccaaa
ggctactgtgtaataggaggttacatgtcacctgcgaatgatgcatacaagaaaaagaac
ctaatatctgctgaacatcgaatacggttatgcaatctagcctgcaaaagttcagaattt
gtaatggttgatccatgggaggcaaatcaaagcacgtatcaacgcactttaactgttctc
tccagggtccacggttctatttgtgagacagggttaagactatatgcagagattatggag
tagtct

DBGET integrated database retrieval system