KEGG   Lotus japonicus: Lj0g3v0081769.1Help
Entry
Lj0g3v0081769.1   CDS       T04348                                 

Gene name
Lj0g3v0081769.1
Definition
(Kazusa) -
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
lja  Lotus japonicus
Brite
KEGG Orthology (KO) [BR:lja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lja01003]
    Lj0g3v0081769.1 (Lj0g3v0081769.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     Lj0g3v0081769.1 (Lj0g3v0081769.1)
Glycosyltransferases [BR:lja01003]
 Polysaccharide
  Structural polysaccharide
   Lj0g3v0081769.1 (Lj0g3v0081769.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
AA seq 229 aa AA seqDB search
MEAFRWCSTASLLLPLFCLILLFTIFTPLKQNYPSFSLFLSPLTTQPKPDQFLTNSAYRS
FEHNTSSSIKKMTSLYRVEGVLAEARASIREAILSRNYSSSSTSGKPKKFIPKGSIYRNP
YSFHQSHVEMVKRLKVWVYEEGEQPLVHDGPLGTIYAIDGQFIDEIDRSRNSPFKARHPD
EANLFLIPFSITNVVKYVYMPILSKKDFHLGRLQQLVEDYVRVVADNYP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctttcggtggtgctccacagcctctctgttattaccattgttttgcctcatt
cttctcttcaccatcttcactccactcaaacaaaactatccttccttctccctttttctt
tcacccctcacaacacaaccaaaacccgatcagtttctgactaactctgcatatagaagc
tttgaacataacacatctagtagcattaagaaaatgactagcttgtatagagttgaagga
gttttggcagaagcacgagcctcaattcgggaagcaattctgtcaaggaactacagtagc
agttctacttcagggaagccaaaaaagtttatcccaaaagggtccatttacagaaatcca
tactcttttcaccagagccatgtggagatggtgaagagattgaaggtttgggtttacgag
gaaggagagcaaccactagtgcatgatgggccattaggcaccatatacgccattgatggt
caattcattgacgaaatcgacagaagcagaaatagccccttcaaggctaggcaccctgat
gaagcaaacctttttctgattccatttagcatcactaatgttgtcaaatatgtttatatg
ccgatcttgtccaaaaaggatttccaccttggccgcctgcaacagttggtggaggactat
gtacgggtggtggctgataattatccctgagta

DBGET integrated database retrieval system