KEGG   Lotus japonicus: Lj0g3v0190979.1Help
Entry
Lj0g3v0190979.1   CDS       T04348                                 

Gene name
Lj0g3v0190979.1
Definition
(Kazusa) -
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
lja  Lotus japonicus
Brite
KEGG Orthology (KO) [BR:lja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lja01002]
    Lj0g3v0190979.1 (Lj0g3v0190979.1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lja03110]
    Lj0g3v0190979.1 (Lj0g3v0190979.1)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     Lj0g3v0190979.1 (Lj0g3v0190979.1)
Peptidases and inhibitors [BR:lja01002]
 Serine peptidases
  Family S8: subtilisin family
   Lj0g3v0190979.1 (Lj0g3v0190979.1)
Chaperones and folding catalysts [BR:lja03110]
 Intramolecular chaperones
  Subtilisin family
   Lj0g3v0190979.1 (Lj0g3v0190979.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
AA seq 1140 aa AA seqDB search
MHNQHTLLLRFPTLPSPSVIVLHLTEAKLSFNTRRIHTARTFFRRSNWVLPKAMSTSSSF
SSRFGGGDDDTTTTTTNNNNNNNNNGASFRNFKLNESTFLASLMPKTEIGVDRFLHSHPY
YDGRGALIAIFDSGVDPAATGLQVTSDGKPKILDILDCTGSGDIDTSKVVNADADGCISG
ASGASLVINTSWKNPSCEWHVGYKLVYELFTEKLTSRMKKERRKKWDKKNQEEIAKAVKQ
LNDFDQQHMKVENVKLKKARGDLQSRLDLLKKQFESYDDKGPAIDAVVWYDGEVWRVALD
TQSLQDDPDCGKLANFVPLTNYRTERKYGVFSKLDACTFVVNVYNDGNVLSIVTDSSPHG
THVAGIATAFHPEEPLLNGVAPGAQLISCKIGDSRLGSMETGTGLTRALIAAVEHKCDLI
NMSYGEPTLLPDYGRFVDLVNEAVNKHRLIFVSSAGNSGPALSTVGAPGGTSSSIIGVGA
YVSPAMAAGAHCVVEPPSEGLEYTWSSRGPTADGDLGVCVSAPGGAIASVPTWTLQRRML
MNGTSMASPSACGGIALLISAMKAEGIPVSPYIVRKALENTSVPIGNSPEDKLSTGQGLM
QVDKCYEYIQQSQNIPYVWYQINVKQSGKSNPSSRGIYLREAAACQQATEWMVQVDPIFH
EDADKFEELVVFEECIELHSSDRTVIKAPEYLLLTHNGRTFNILVDPTNLCDGLHYYEVY
GIDCKAPWRGPLFRIPITITKPMALTNRSPQVSFSKMLFQPGHIERKYIEVPHGASWVEA
TINASSFDTARRFFVDAVQICPLQRPFKWRNVISFSSPAAKSFTFRVIGGQTLELVIAQL
WSSGIGSHETTNVDLEVVFHGVQVNQEEIVLDGSEAPLRIDAEALLASEKLAPVAILNKI
RIPYRPIDAKISSLSTDRDKLPSGKQILALTLTYKIKLEDGAEIKPQIPFLNGRMYDTKF
ESQFYMISDSNKKVHSSGDAYPNPTKLPKGEYNLQLYLRHDNLQILEKLKQLVLFIERNL
EEKDIIRLCFFSQPDGPLIGNGSFKSSTLIPGIKEGFYLGPPPKDKLPKNSPQGSVLVGS
ISYGKLSLASHGEHKNPEKHPVSYRISYIVPPNKIDEDKGKTSSSSPKKTVSERLEEEVR
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgcataatcaacacacgctcttactcagattccccacattgccctctccctctgtcatc
gtccttcatctcacagaggcaaagctcagcttcaacacgagaagaatacacactgcgaga
accttcttcagaagaagcaactgggttctccccaaggcaatgtctactagctcttccttc
agctctcgctttggtggcggcgatgatgacaccaccaccaccaccaccaacaacaacaac
aacaacaacaataacggtgcttctttccgcaacttcaagctgaacgagtcaacattcttg
gcttcgctcatgcccaagacagagattggcgttgaccggtttctccattctcacccatac
tatgatggacgcggtgctctcatcgctatcttcgattctggtgtagacccggctgctacg
ggattacaggttacctcagatgggaagccgaaaattcttgatattcttgattgcactggg
agcggtgatattgatacctcaaaggtggtgaacgcagatgctgatggttgtatttctggg
gcatcaggggcatctttggttatcaatacttcatggaaaaatccttcttgtgaatggcat
gtgggttataaattggtttatgagctcttcactgaaaaattaacttctcgtatgaagaaa
gaaagaaggaaaaagtgggacaagaaaaaccaggaggaaattgctaaggctgtaaaacaa
cttaatgattttgatcagcaacacatgaaggtggagaatgttaaactcaaaaaggctcgc
ggagatctacagagtaggcttgatcttcttaaaaagcaatttgagagctatgatgataag
gggcctgccatagatgctgtcgtctggtatgatggagaagtttggagggttgctcttgac
acacagagtcttcaggatgatccagattgtgggaagcttgctaactttgtacccttaact
aactataggacagagaggaagtatggtgtcttcagcaaactagatgcttgtacatttgtt
gtgaatgtctataatgatgggaatgtcttaagtattgtaacagacagctctcctcacggc
acccatgttgctggtatagctactgcattccacccagaggaacctttgttaaatggagtt
gcacctggagcacaattaatttcttgtaaaattggggactctcgcttaggttcaatggaa
actggaactggtttgactcgggcattgatagctgctgttgagcataaatgcgaccttatc
aacatgagttatggtgagccaacactactgccagactatggacgctttgttgaccttgtg
aacgaagcagtaaacaagcaccgtctgatatttgtgagcagtgctggtaatagtgggcca
gcattgagcactgttggtgcacctggcggtacatcttcaagtatcataggtgttggcgct
tatgtttctcctgctatggcagcaggtgctcactgtgttgttgaacctccttctgaaggg
cttgaatacacttggtctagccgaggaccaacagctgatggagatcttggtgtctgtgtg
agtgctcctggtggtgctattgcttctgtccctacttggactcttcaacggcgcatgctc
atgaatgggacatcaatggcatctccgtcagcttgtggtggaattgcattgctcataagt
gcaatgaaggctgaaggaattcctgtgagtccatatattgtgaggaaggcccttgagaat
acatctgttcccataggcaattcacctgaggataaattatctactgggcaagggctgatg
caagttgacaagtgttatgaatatatacagcagtctcaaaatattccatatgtttggtat
caaataaacgtcaagcaatctggaaaatcaaatccttcatcacggggcatctacttgaga
gaggctgctgcttgccaacaagctactgagtggatggtgcaagttgatccaatatttcac
gaagatgccgacaagtttgaagaattagttgtgtttgaggagtgcattgagttacactca
tcagataggacagtaattaaagcccccgagtatctactgctcactcacaatggtcgtacc
ttcaacatattagtggatcctaccaatttatgtgatggtctgcattattatgaggtctat
ggtattgactgcaaagcaccatggcgtggccctcttttcagaattccaattactataacc
aagcctatggctcttactaacagatctccacaagtttcattttcaaagatgttattccag
ccaggccatatagaaaggaaatacatagaagtgccacatggtgcatcttgggttgaagca
accataaacgcatccagttttgatactgctcgaagattttttgtggacgcagttcagata
tgtccactgcaaagaccttttaaatggaggaatgtgatatccttttcatccccggctgcc
aaaagcttcacctttagggtaataggtggtcagacattggaactagtcatagctcagctt
tggtcaagtggaatcgggagtcatgagactaccaatgtggatcttgaggttgtgtttcat
ggtgtacaagtcaatcaagaggaaattgtacttgatgggagtgaagccccactcagaatt
gatgctgaagcactactggcatctgagaaacttgctcctgtagcaattctaaataagata
aggatcccatatcgaccaatagatgctaagattagttcactttcaactgatcgtgacaaa
ctcccctctggaaagcagatacttgcattgacattaacatacaagatcaaattggaagat
ggagctgaaatcaaacctcaaataccatttctaaatggtcggatgtatgatactaaattt
gagtctcaattttatatgatttctgattcaaataagaaagtacattcaagtggagatgcc
tatccgaaccctacaaaacttcccaagggcgaatataatttacagttatatttgaggcat
gacaacttgcagattttggaaaagttgaagcagctagtgttattcattgagcgaaatttg
gaagagaaggacatcattaggttgtgctttttctctcaaccagatggtccactgatagga
aatggttcctttaagtcttcgacattaattccagggataaaagaaggcttttatcttggc
ccaccaccaaaagacaagcttcccaagaactctccacaaggatctgtattggtgggatct
atatcatatgggaaactatcattagccagtcacggggagcataaaaatccagaaaagcac
cctgtatcatatcggatttcttatatagttccgccaaataagattgatgaggacaaggga
aaaacttcctcctcatctcccaagaagacagtttctgaacgtttagaagaagaggtacgc

DBGET integrated database retrieval system