KEGG   Lotus japonicus: Lj0g3v0197689.2Help
Entry
Lj0g3v0197689.2   CDS       T04348                                 

Gene name
Lj0g3v0197689.2
Definition
(Kazusa) -
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
lja  Lotus japonicus
Pathway
lja00010  Glycolysis / Gluconeogenesis
lja00562  Inositol phosphate metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lj0g3v0197689.2 (Lj0g3v0197689.2)
   00562 Inositol phosphate metabolism
    Lj0g3v0197689.2 (Lj0g3v0197689.2)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Lj0g3v0197689.2 (Lj0g3v0197689.2)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Lj0g3v0197689.2 (Lj0g3v0197689.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
AA seq 291 aa AA seqDB search
MKKAMAFVLLIFLSVVHYSNAEEAFDVRKHLSTVSRYGAVKDIADNNFVPSNIPEGCVPI
HLNLVARHGTRSPTKKRIGAMDNLSARLEVLLRDAEERKLPLERLPSWINGWKSPWQGRL
KGGELVSKGEDELYDLGIRVREKFPNLFDEEYHPVIYPIKATQVPRASASAVAFGMGLFS
GNGSLGPGRHRAFAVTSESRASDIQLRFHDCCHNYKDIRKRQEPAVDKLKEPVLEEITSA
LVGRYGLNFTRQDTSSLWFLCKQVITFLYPQLLLFYAMSFFEFTCNHLLML
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagccatggcttttgttctgttaatatttctttcagttgtacattactcaaat
gctgaagaagctttcgatgttcgcaaacatctctccactgtctccagatatggtgctgtg
aaagacattgctgacaacaactttgtaccttctaatattcccgaaggatgtgttccaata
catttaaatcttgtggcgaggcatggaactcgttccccgacgaagaaaaggataggagcg
atggataatttgtcagctcgtctggaggttcttttaagggatgcagaagaacgaaaattg
cctttggagagacttccctcctggataaatgggtggaaatctccttggcaaggaaggctt
aagggtggtgagttagttagcaaaggagaggatgaactatatgatcttggaatcagggtt
agagaaaagtttcctaatttgtttgatgaagaataccatccagtcatatatcctataaag
gcaacccaagttccgcgagcatcagctagtgctgtggcatttggaatggggcttttcagt
ggcaatggaagtcttggacctgggcgtcatcgagcttttgctgttaccagtgaaagccgt
gctagtgacatccaactgagatttcatgattgttgtcataactacaaggatatcaggaaa
aggcaggaacctgcagtcgataaacttaaggaacctgtgcttgaggagattacatctgca
ttagttgggcgatatgggctgaatttcacaaggcaggatacatcctctctctggtttttg
tgtaaacaggtaattacatttctttatcctcagctccttctgttttacgctatgtccttt
tttgagtttacatgtaatcacttgctaatgttatagaga

DBGET integrated database retrieval system