KEGG   Lotus japonicus: Lj0g3v0254699.2Help
Entry
Lj0g3v0254699.2   CDS       T04348                                 

Gene name
Lj0g3v0254699.2
Definition
(Kazusa) -
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
lja  Lotus japonicus
Brite
KEGG Orthology (KO) [BR:lja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lja03041]
    Lj0g3v0254699.2 (Lj0g3v0254699.2)
   03110 Chaperones and folding catalysts [BR:lja03110]
    Lj0g3v0254699.2 (Lj0g3v0254699.2)
Enzymes [BR:lja01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Lj0g3v0254699.2 (Lj0g3v0254699.2)
Spliceosome [BR:lja03041]
 Complex C
  Other components
   PPlases
    Lj0g3v0254699.2 (Lj0g3v0254699.2)
Chaperones and folding catalysts [BR:lja03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Lj0g3v0254699.2 (Lj0g3v0254699.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
AA seq 476 aa AA seqDB search
MSTVYVLEPPTKGKVVVNTTRGPIDIELWPKEAPKAVRNFVQLCLEGYYDNTIFHRIIKD
FLIQCGDPTGTGTGGESIYGDAFADEFHSRLKFKHRGIVAMANAGSPNSNGSQFFITLDR
CDWLDKKHTIFGKVTGDTLYNLLRLGEAETDKNDRPLEPPKILSIEVLWNPFEDIIPRTL
QKSQTKATTDAEKKDSKKKGVKNLSLLSFGEETEEDEKELTLVKQKIKSSHDVLNDPRLL
KDETSINDLGSSDDKSRRNLQLSVRDALSSKKEEPQKDSKADNSAHLDSRDDDEAGFDSR
MRMQILKKRKELGDLPPKPDLQNGRPSSEDRDTSAARSGALSSDEDQRRAEKLSLKKKGV
GSEARAKRIANADTDFQLLNEAERGRQLQKQKKRRLQGREDDVLAKLEKFKNAQSAKEKP
TTDESEQVNKEELSDWRSATLKFGPESGKDRMSRKEDPNDYVVHDPLLEKGKEKFN
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggtgtacgttcttgaaccgccaactaaggggaaggtggtggtgaacacgacg
cgcggccctattgacattgagctctggcccaaagaggctcccaaagccgtcaggaacttc
gtgcagctctgcctcgaaggctactacgacaacaccatcttccaccgcatcatcaaggac
ttcctcatccagtgtggtgaccccaccggtaccggcaccggaggtgaaagtatttatggg
gatgcttttgctgatgagttccactcgcggctaaagttcaaacacagaggtatagttgca
atggccaatgctggatctccgaattccaatggaagtcagtttttcataactctcgatcgc
tgtgactggctcgataagaagcatactatttttggaaaggtgacgggagatactttgtat
aatctgttgagactgggtgaagctgaaaccgacaagaatgaccgacctttagagccacca
aagatattatccattgaggtgttgtggaacccatttgaagatattattccaagaacgctt
cagaaatctcagactaaagctacaactgatgcagaaaaaaaagattcaaagaagaaagga
gttaagaatttgagcttgctttcatttggggaagaaactgaagaagatgaaaaggaattg
acattagtgaagcaaaagatcaagagcagtcatgatgtcttgaatgatcctcgtcttcta
aaggatgaaacttctattaatgatttgggttcatctgatgataaatcaagaaggaatctg
caattatctgtaagagatgcacttagctcaaagaaagaagagcctcagaaggattcaaaa
gctgataattcagctcatcttgattcccgtgatgacgatgaagcaggttttgattcaaga
atgcgcatgcaaatactcaaaaagcggaaggaattgggcgatctccctcccaagccagat
ttgcaaaatggaagacccagttcagaggatcgtgatacgtcagcagccaggtccggtgct
ttaagttctgatgaggatcaacgaagagcggaaaaattgtccttgaagaaaaagggagta
ggatctgaagcaagagctaaacgaatagctaatgcagatacagattttcagctactgaat
gaagctgagagaggaagacagttgcagaagcagaagaaacgcagacttcaggggcgtgaa
gatgatgttctggcaaaacttgaaaaatttaagaatgctcaatcagcaaaggagaaaccc
acaactgatgaatctgaacaagttaataaggaggaattatctgactggagaagcgctacc
ttaaaatttggccctgagtctggcaaggaccggatgtcacgcaaagaggacccaaatgac
tacgttgtgcatgatcctcttttggagaaagggaaggagaagtttaac

DBGET integrated database retrieval system